StarFunc result for job id P04181

User Input

>input (439 residues)
MFSKLAHLQRFAVLSRGVHSSVASATSVATKKTVQGPPTSDDIFEREYKYGAHNYHPLPV
ALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVL
GEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGR
TLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVV
PDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYP
VSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNEL
MKLPSDVVTAVRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI
KEDELRESIEIINKTILSF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VJQ4	0.966	0.966	3.819E-90	439	1.000	1.000	A0A140VJQ4.pdb.gz	A0A140VJQ4_HUMAN Ornithine aminotransferase OS=Homo sapiens OX=9606 PE=2 SV=1
2	PDB:2byjA	0.919	0.999	6.013E-82	404	0.918	0.998	2byjA.pdb.gz	Determinants of Substrate Specificity in Omega-Aminotransferases.
3	AFDB:Q9VW26	0.917	0.934	4.237E-71	431	0.679	0.691	Q9VW26.pdb.gz	OAT_DROME Ornithine aminotransferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Oat PE=2 SV=1
4	AFDB:Q6LFH8	0.898	0.952	1.190E-61	414	0.510	0.541	Q6LFH8.pdb.gz	OAT_PLAF7 Ornithine aminotransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=OAT PE=1 SV=1
5	AFDB:Q54JP5	0.909	0.959	2.790E-61	416	0.513	0.541	Q54JP5.pdb.gz	OAT_DICDI Probable ornithine aminotransferase OS=Dictyostelium discoideum OX=44689 GN=oatA PE=3 SV=1
6	AFDB:Q10G56	0.911	0.847	1.222E-60	473	0.497	0.461	Q10G56.pdb.gz	OAT_ORYSJ Ornithine aminotransferase, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=OAT PE=2 SV=1
7	AFDB:Q9FNK4	0.902	0.835	5.995E-60	475	0.490	0.453	Q9FNK4.pdb.gz	OAT_ARATH Ornithine aminotransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DELTA-OAT PE=1 SV=1
8	AFDB:Q9P7L5	0.898	0.900	8.887E-58	438	0.519	0.521	Q9P7L5.pdb.gz	OAT_SCHPO Ornithine aminotransferase car2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=car2 PE=2 SV=1
9	AFDB:P38021	0.899	0.984	2.334E-57	401	0.449	0.491	P38021.pdb.gz	OAT_BACSU Ornithine aminotransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=rocD PE=1 SV=2
10	AFDB:Q92413	0.904	0.875	7.270E-57	454	0.515	0.498	Q92413.pdb.gz	OAT_EMENI Ornithine aminotransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=otaA PE=1 SV=2
11	AFDB:Q6FK60	0.901	0.917	4.230E-56	431	0.497	0.506	Q6FK60.pdb.gz	Q6FK60_CANGA Ornithine aminotransferase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAR2 PE=3 SV=1
12	PDB:3ntjB	0.831	0.925	1.194E-55	393	0.490	0.547	3ntjB.pdb.gz
13	PDB:4adbB	0.848	0.926	8.706E-40	401	0.296	0.324	4adbB.pdb.gz	Determination of the Structure of the Catabolic N-Succinylornithine Transaminase (Astc) from Escherichia Coli.
14	PDB:5h7dA	0.851	0.757	6.006E-39	495	0.289	0.257	5h7dA.pdb.gz	Construction of novel repeat proteins with rigid and predictable structures using a shared helix method.
15	PDB:7jh3A	0.837	0.874	4.503E-37	420	0.289	0.302	7jh3A.pdb.gz
16	PDB:1sf2A	0.835	0.861	5.339E-37	425	0.280	0.289	1sf2A.pdb.gz	Crystal structures of unbound and aminooxyacetate-bound Escherichia coli gamma-aminobutyrate aminotransferase.
17	PDB:4ppmA	0.841	0.797	6.142E-36	464	0.285	0.269	4ppmA.pdb.gz	Crystal structure of the catalytic domain of PigE: a transaminase involved in the biosynthesis of 2-methyl-3-n-amyl-pyrrole (MAP) from Serratia sp. FS14
18	PDB:4adeB	0.742	0.923	7.678E-34	350	0.269	0.337	4adeB.pdb.gz
19	PDB:4a6tC	0.836	0.808	1.047E-32	455	0.241	0.233	4a6tC.pdb.gz	Crystal Structures of the Chromobacterium Violaceum Omega-Transaminase Reveal Major Structural Rearrangements Upon Binding of Coenzyme Plp.
20	PDB:4b98A	0.797	0.794	1.512E-31	441	0.257	0.256	4b98A.pdb.gz	Structural Studies with Pseudomonas and Chromobacterium [Omega]-Aminotransferases Provide Insights Into Their Differing Substrate Specificity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJQ4	0.0	907	439	1.000	1.000	A0A140VJQ4_HUMAN Ornithine aminotransferase OS=Homo sapiens OX=9606 PE=2 SV=1
2	P04181	0.0	907	439	1.000	1.000	OAT_HUMAN Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1
3	P04182	0.0	836	439	0.907	0.907	OAT_RAT Ornithine aminotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Oat PE=1 SV=1
4	P29758	0.0	839	439	0.909	0.909	OAT_MOUSE Ornithine aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Oat PE=1 SV=1
5	Q9VW26	0.0	643	431	0.695	0.708	OAT_DROME Ornithine aminotransferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Oat PE=2 SV=1
6	Q6LFH8	5.16e-163	467	414	0.510	0.541	OAT_PLAF7 Ornithine aminotransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=OAT PE=1 SV=1
7	Q92413	5.79e-163	468	454	0.524	0.507	OAT_EMENI Ornithine aminotransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=otaA PE=1 SV=2
8	Q54JP5	2.05e-162	466	416	0.513	0.541	OAT_DICDI Probable ornithine aminotransferase OS=Dictyostelium discoideum OX=44689 GN=oatA PE=3 SV=1
9	Q9P7L5	4.68e-162	466	438	0.524	0.525	OAT_SCHPO Ornithine aminotransferase car2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=car2 PE=2 SV=1
10	Q10G56	1.02e-150	438	473	0.483	0.448	OAT_ORYSJ Ornithine aminotransferase, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=OAT PE=2 SV=1
11	Q9FNK4	2.10e-146	427	475	0.478	0.442	OAT_ARATH Ornithine aminotransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DELTA-OAT PE=1 SV=1
12	Q6FK60	1.52e-145	423	431	0.494	0.503	Q6FK60_CANGA Ornithine aminotransferase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAR2 PE=3 SV=1
13	P07991	1.04e-141	413	424	0.501	0.519	OAT_YEAST Ornithine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAR2 PE=1 SV=2
14	P38021	4.76e-139	405	401	0.449	0.491	OAT_BACSU Ornithine aminotransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=rocD PE=1 SV=2
15	P18335	7.74e-75	241	406	0.319	0.345	ARGD_ECOLI Acetylornithine/succinyldiaminopimelate aminotransferase OS=Escherichia coli (strain K12) OX=83333 GN=argD PE=1 SV=4
16	O30508	4.21e-71	231	406	0.308	0.333	ARUC_PSEAE Succinylornithine transaminase/acetylornithine aminotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=aruC PE=1 SV=2
17	P77581	8.67e-63	210	406	0.301	0.325	ASTC_ECOLI Succinylornithine transaminase OS=Escherichia coli (strain K12) OX=83333 GN=astC PE=1 SV=1
18	P42588	9.59e-63	211	459	0.294	0.281	PAT_ECOLI Putrescine aminotransferase OS=Escherichia coli (strain K12) OX=83333 GN=patA PE=1 SV=2
19	O74548	6.20e-62	209	441	0.333	0.331	ARGD_SCHPO Probable acetylornithine aminotransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arg1 PE=2 SV=1
20	P94427	8.01e-60	203	436	0.308	0.310	GABT_BACSU Probable 4-aminobutyrate aminotransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=gabT PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00202 Aminotran_3	2.4e-116	400.4	Aminotransferase class-III

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357838

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360268	0.998	Delta-1-pyrroline-5-carboxylate synthase
2	9606.ENSP00000349446	0.994	Arginase-1
3	9606.ENSP00000261783	0.990	Arginase-2, mitochondrial
4	9606.ENSP00000234111	0.983	Ornithine decarboxylase
5	9606.ENSP00000364490	0.982	Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
6	9606.ENSP00000039007	0.955	Ornithine carbamoyltransferase, mitochondrial
7	9606.ENSP00000361471	0.906	Argininosuccinate synthase
8	9606.ENSP00000293404	0.878	N-acetylglutamate synthase, mitochondrial
9	9606.ENSP00000307188	0.851	Argininosuccinate lyase
10	9606.ENSP00000349577	0.844	Proline dehydrogenase
11	9606.ENSP00000481127	0.842	Proline dehydrogenase 1, mitochondrial
12	9606.ENSP00000384949	0.825	Pyrroline-5-carboxylate reductase 1, mitochondrial
13	9606.ENSP00000220966	0.798	Pyrroline-5-carboxylate reductase 3
14	9606.ENSP00000364986	0.793	Agmatinase, mitochondrial
15	9606.ENSP00000294517	0.781	Antizyme inhibitor 2
16	9606.ENSP00000359680	0.740	4-hydroxy-2-oxoglutarate aldolase, mitochondrial
17	9606.ENSP00000366156	0.730	Spermidine synthase
18	9606.ENSP00000277865	0.725	Glutamate dehydrogenase 1, mitochondrial
19	9606.ENSP00000342502	0.725	Pyrroline-5-carboxylate reductase 2
20	9606.ENSP00000385746	0.722	Spermine synthase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008483	1.000	transaminase activity
GO:0005488	0.997	binding
GO:0005515	0.936	protein binding
GO:0042802	0.696	identical protein binding
GO:0097159	0.621	organic cyclic compound binding
GO:1901363	0.619	heterocyclic compound binding
GO:0043167	0.312	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.994	organic substance metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0044238	0.991	primary metabolic process
GO:1901605	0.977	alpha-amino acid metabolic process
GO:0032501	0.689	multicellular organismal process
GO:0050953	0.637	sensory perception of light stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0005634	0.979	nucleus
GO:0031981	0.757	nuclear lumen
GO:0005654	0.682	nucleoplasm
GO:0005759	0.673	mitochondrial matrix
GO:0005829	0.373	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.6.1.-	1.000	Transaminases.

[back to server]