StarFunc result for job id P04196

User Input

>input (525 residues)
MKALIAALLLITLQYSCAVSPTDCSAVEPEAEKALDLINKRRRDGYLFQLLRIADAHLDR
VENTTVYYLVLDVQESDCSVLSRKYWNDCEPPDSRRPSEIVIGQCKVIATRHSHESQDLR
VIDFNCTTSSVSSALANTKDSPVLIDFFEDTERYRKQANKALEKYKEENDDFASFRVDRI
ERVARVRGGEGTGYFVDFSVRNCPRHHFPRHPNVFGFCRADLFYDVEALDLESPKNLVIN
CEVFDPQEHENINGVPPHLGHPFHWGGHERSSTTKPPFKPHGSRDHHHPHKPHEHGPPPP
PDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNGAQRHSHNNNSSDLHPHKHHSHEQH
PHGHHPHAHHPHEHDTHRQHPHGHHPHGHHPHGHHPHGHHPHGHHPHCHDFQDYGPCDPP
PHNQGHCCHGHGPPPGHLRRRGPGKGPRPFHCRQIGSVYRLPPLRKGEVLPLPEANFPSF
PLPHHKHPLKPDNQPFPQSVSESCPGKFKSGFPQVSMFFTHTFPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04196	1.000	1.000	7.874E-91	525	1.000	1.000	P04196.pdb.gz	HRG_HUMAN Histidine-rich glycoprotein OS=Homo sapiens OX=9606 GN=HRG PE=1 SV=1
2	AFDB:Q28640	0.615	0.614	9.137E-55	526	0.621	0.620	Q28640.pdb.gz	HRG_RABIT Histidine-rich glycoprotein (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=HRG PE=1 SV=1
3	AFDB:Q9ESB3	0.645	0.645	1.205E-54	525	0.625	0.625	Q9ESB3.pdb.gz	HRG_MOUSE Histidine-rich glycoprotein OS=Mus musculus OX=10090 GN=Hrg PE=1 SV=2
4	PDB:6ht9B	0.343	0.548	4.402E-14	316	0.118	0.196	6ht9B.pdb.gz	Structure of mammalian plasma fetuin-B and its mechanism of selective metallopeptidase inhibition.
5	PDB:3lh4A	0.172	0.692	8.258E-4	115	0.036	0.165	3lh4A.pdb.gz
6	PDB:1rn7A	0.167	0.642	1.089E-3	112	0.032	0.152	1rn7A.pdb.gz
7	PDB:1yvbI	0.170	0.703	1.519E-3	111	0.036	0.171	1yvbI.pdb.gz
8	PDB:2ch9A	0.184	0.683	2.238E-3	126	0.036	0.151	2ch9A.pdb.gz	Structural Basis of Reduction-Dependent Activation of Human Cystatin F.
9	PDB:4n6mA	0.178	0.713	3.121E-3	117	0.038	0.171	4n6mA.pdb.gz
10	PDB:6uioA	0.178	0.745	3.299E-3	112	0.038	0.179	6uioA.pdb.gz	Maturation of the functional mouse CRES amyloid from globular form.
11	AFDB:Q98TW1	0.111	0.051	6.431E-3	1505	0.122	0.043	Q98TW1.pdb.gz	NCOA2_DANRE Nuclear receptor coactivator 2 OS=Danio rerio OX=7955 GN=ncoa2 PE=1 SV=1
12	PDB:2bo9B	0.125	0.254	7.164E-3	217	0.046	0.111	2bo9B.pdb.gz	Structure of Human Carboxypeptidase A4 with its Endogenous Protein Inhibitor, Latexin.
13	PDB:1wnhA	0.145	0.303	8.942E-3	220	0.038	0.091	1wnhA.pdb.gz
14	AFDB:P32927	0.082	0.055	1.476E-2	897	0.166	0.097	P32927.pdb.gz	IL3RB_HUMAN Cytokine receptor common subunit beta OS=Homo sapiens OX=9606 GN=CSF2RB PE=1 SV=2
15	AFDB:Q09847	0.071	0.040	4.994E-2	1325	0.105	0.042	Q09847.pdb.gz	NU146_SCHPO Nucleoporin nup146 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup146 PE=1 SV=1
16	AFDB:F8VR32	0.087	0.059	5.579E-2	938	0.103	0.058	F8VR32.pdb.gz	F8VR32_HUMAN Neuronal PAS domain protein 3 OS=Homo sapiens OX=9606 GN=NPAS3 PE=1 SV=1
17	AFDB:Q2UNT7	0.070	0.066	6.588E-2	574	0.137	0.125	Q2UNT7.pdb.gz	VEA_ASPOR Developmental and secondary metabolism regulator veA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=veA PE=3 SV=1
18	AFDB:E7F5M0	0.069	0.040	6.963E-2	1218	0.112	0.048	E7F5M0.pdb.gz
19	PDB:6rpvA	0.141	0.462	7.757E-2	120	0.038	0.167	6rpvA.pdb.gz
20	AFDB:F4KB17	0.067	0.049	7.779E-2	839	0.118	0.074	F4KB17.pdb.gz	KTN83_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3 OS=Arabidopsis thaliana OX=3702 GN=KTN80.3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P04196	0.0	1060	525	1.000	1.000	HRG_HUMAN Histidine-rich glycoprotein OS=Homo sapiens OX=9606 GN=HRG PE=1 SV=1
2	Q28640	2.52e-132	396	526	0.410	0.409	HRG_RABIT Histidine-rich glycoprotein (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=HRG PE=1 SV=1
3	Q9ESB3	4.89e-121	367	525	0.368	0.368	HRG_MOUSE Histidine-rich glycoprotein OS=Mus musculus OX=10090 GN=Hrg PE=1 SV=2
4	Q9UGM5	9.10e-16	81.3	382	0.122	0.168	FETUB_HUMAN Fetuin-B OS=Homo sapiens OX=9606 GN=FETUB PE=1 SV=2
5	A0A060Y5T9	1.27e-13	75.5	491	0.272	0.291	A0A060Y5T9_ONCMY Cystatin fetuin-B-type domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00022832001 PE=4 SV=1
6	Q9QXC1	1.64e-12	71.6	388	0.135	0.183	FETUB_MOUSE Fetuin-B OS=Mus musculus OX=10090 GN=Fetub PE=1 SV=1
7	Q3URU2	4.46e-07	55.5	1571	0.053	0.018	PEG3_MOUSE Paternally-expressed gene 3 protein OS=Mus musculus OX=10090 GN=Peg3 PE=1 SV=1
8	P01042	9.85e-05	47.4	644	0.057	0.047	KNG1_HUMAN Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1 PE=1 SV=2
9	X2JC49	0.034	39.7	4233	0.046	0.006	X2JC49_DROME Ankyrin 2, isoform Z OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
10	A8JNM5	0.035	39.7	4264	0.046	0.006	A8JNM5_DROME Ankyrin 2, isoform K OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
11	M9MRS5	0.035	39.7	4496	0.046	0.005	M9MRS5_DROME Ankyrin 2, isoform R OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
12	M9PEN3	0.035	39.7	4373	0.046	0.005	M9PEN3_DROME Ankyrin 2, isoform V OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
13	P26436	0.13	37.0	265	0.050	0.098	ASPX_HUMAN Acrosomal protein SP-10 OS=Homo sapiens OX=9606 GN=ACRV1 PE=1 SV=2
14	Q6S9I0	0.15	37.0	433	0.050	0.060	Q6S9I0_MOUSE Kininogen 2 OS=Mus musculus OX=10090 GN=Kng2 PE=1 SV=1
15	A0A1D8PGH4	0.20	37.0	2624	0.055	0.011	A0A1D8PGH4_CANAL 1-phosphatidylinositol-3-phosphate 5-kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FAB1 PE=4 SV=1
16	P08934	0.38	35.8	639	0.050	0.041	KNG1_RAT Kininogen-1 OS=Rattus norvegicus OX=10116 GN=Kng1 PE=2 SV=1
17	O08677	1.3	34.3	661	0.088	0.070	KNG1_MOUSE Kininogen-1 OS=Mus musculus OX=10090 GN=Kng1 PE=1 SV=1
18	O96201	2.2	33.9	1844	0.023	0.007	O96201_PLAF7 Transcription factor with AP2 domain(S) OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0212100 PE=4 SV=1
19	Q7Z429	2.7	33.1	371	0.029	0.040	LFG1_HUMAN Protein lifeguard 1 OS=Homo sapiens OX=9606 GN=GRINA PE=1 SV=1
20	M9NEY8	5.0	32.7	2860	0.063	0.012	TET_DROME Methylcytosine dioxygenase TET OS=Drosophila melanogaster OX=7227 GN=Tet PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00666 Cathelicidins	3.1	19.5	Cathelicidin
2	PF00031 Cystatin	8.9e-08	43.6	Cystatin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000232003

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308938	0.999	Plasminogen
2	9606.ENSP00000356671	0.931	Antithrombin-III
3	9606.ENSP00000306361	0.921	Fibrinogen alpha chain
4	9606.ENSP00000361850	0.914	Urokinase-type plasminogen activator
5	9606.ENSP00000339328	0.902	Urokinase plasminogen activator surface receptor
6	9606.ENSP00000393887	0.902	Alpha-2-HS-glycoprotein
7	9606.ENSP00000421725	0.898	Vitamin D-binding protein
8	9606.ENSP00000168148	0.887	Secreted phosphoprotein 24
9	9606.ENSP00000260356	0.878	Thrombospondin-1
10	9606.ENSP00000336829	0.841	Fibrinogen gamma chain
11	9606.ENSP00000306099	0.839	Fibrinogen beta chain
12	9606.ENSP00000277903	0.838	Hyaluronan-binding protein 2
13	9606.ENSP00000265983	0.805	Hemopexin
14	9606.ENSP00000351190	0.783	Inter-alpha-trypsin inhibitor heavy chain H2
15	9606.ENSP00000302620	0.766	Alanine-glyoxylate aminotransferase
16	9606.ENSP00000220809	0.762	Tissue-type plasminogen activator
17	9606.ENSP00000265023	0.735	Kininogen-1
18	9606.ENSP00000265029	0.732	Fetuin-B
19	9606.ENSP00000233242	0.730	Apolipoprotein B-100
20	9606.ENSP00000181383	0.722	Carboxypeptidase B2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005102	0.985	signaling receptor binding
GO:1901681	0.955	sulfur compound binding
GO:0043167	0.943	ion binding
GO:0005539	0.936	glycosaminoglycan binding
GO:0008201	0.933	heparin binding
GO:0043169	0.931	cation binding
GO:0019865	0.931	immunoglobulin binding
GO:0043395	0.931	heparan sulfate proteoglycan binding
GO:0020037	0.930	heme binding
GO:0008270	0.923	zinc ion binding
GO:0098772	0.851	molecular function regulator activity
GO:0030234	0.796	enzyme regulator activity
GO:0004857	0.744	enzyme inhibitor activity
GO:0030414	0.413	peptidase inhibitor activity
GO:0004866	0.388	endopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0019730	0.985	antimicrobial humoral response
GO:0009987	0.983	cellular process
GO:0061844	0.983	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0048584	0.972	positive regulation of response to stimulus
GO:0030193	0.971	regulation of blood coagulation
GO:0032102	0.969	negative regulation of response to external stimulus
GO:0040008	0.968	regulation of growth
GO:0050794	0.958	regulation of cellular process
GO:0051128	0.953	regulation of cellular component organization
GO:2000146	0.945	negative regulation of cell motility
GO:0010632	0.944	regulation of epithelial cell migration
GO:0030336	0.944	negative regulation of cell migration
GO:0051246	0.939	regulation of protein metabolic process
GO:0034103	0.934	regulation of tissue remodeling
GO:0010594	0.933	regulation of endothelial cell migration
GO:0002682	0.932	regulation of immune system process
GO:0010633	0.925	negative regulation of epithelial cell migration
GO:0010596	0.923	negative regulation of endothelial cell migration
GO:0045765	0.907	regulation of angiogenesis
GO:0051093	0.903	negative regulation of developmental process
GO:0048522	0.892	positive regulation of cellular process
GO:0016525	0.892	negative regulation of angiogenesis
GO:0030155	0.882	regulation of cell adhesion
GO:0051240	0.849	positive regulation of multicellular organismal process
GO:0032501	0.827	multicellular organismal process
GO:0010468	0.775	regulation of gene expression
GO:0010810	0.756	regulation of cell-substrate adhesion
GO:0001952	0.721	regulation of cell-matrix adhesion
GO:0044087	0.701	regulation of cellular component biogenesis
GO:0061045	0.653	negative regulation of wound healing
GO:0001558	0.621	regulation of cell growth
GO:0150116	0.566	regulation of cell-substrate junction organization
GO:0042060	0.560	wound healing
GO:0050817	0.554	coagulation
GO:0007599	0.554	hemostasis
GO:0007596	0.531	blood coagulation
GO:0002684	0.505	positive regulation of immune system process
GO:0050776	0.500	regulation of immune response
GO:0045926	0.467	negative regulation of growth
GO:0050778	0.463	positive regulation of immune response
GO:0045785	0.456	positive regulation of cell adhesion
GO:0031323	0.449	regulation of cellular metabolic process
GO:0030308	0.420	negative regulation of cell growth
GO:0009966	0.417	regulation of signal transduction
GO:0002831	0.416	regulation of response to biotic stimulus
GO:1901888	0.415	regulation of cell junction assembly
GO:0009620	0.414	response to fungus
GO:0008152	0.401	metabolic process
GO:0002833	0.398	positive regulation of response to biotic stimulus
GO:0050920	0.395	regulation of chemotaxis
GO:0090109	0.384	regulation of cell-substrate junction assembly
GO:0050832	0.373	defense response to fungus
GO:0010811	0.370	positive regulation of cell-substrate adhesion
GO:0010941	0.362	regulation of cell death
GO:0001932	0.361	regulation of protein phosphorylation
GO:0071704	0.345	organic substance metabolic process
GO:0051893	0.345	regulation of focal adhesion assembly
GO:0050922	0.342	negative regulation of chemotaxis
GO:0001954	0.337	positive regulation of cell-matrix adhesion
GO:0042127	0.322	regulation of cell population proliferation
GO:0042981	0.306	regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0031410	0.999	cytoplasmic vesicle
GO:0005886	0.998	plasma membrane
GO:0062023	0.998	collagen-containing extracellular matrix
GO:0070013	0.998	intracellular organelle lumen
GO:0005576	0.995	extracellular region
GO:0070062	0.993	extracellular exosome
GO:0072562	0.992	blood microparticle
GO:0034774	0.985	secretory granule lumen
GO:0031091	0.963	platelet alpha granule
GO:0009986	0.960	cell surface
GO:0031093	0.949	platelet alpha granule lumen
GO:0005783	0.623	endoplasmic reticulum
GO:0005788	0.519	endoplasmic reticulum lumen
GO:0031090	0.300	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]