StarFunc result for job id P04198

User Input

>input (464 residues)
MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
LSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGF
SAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELA
HPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPG
GRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT
VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLK
SVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV
VILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04198	0.999	0.999	1.028E-66	464	1.000	1.000	P04198.pdb.gz	MYCN_HUMAN N-myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYCN PE=1 SV=2
2	AFDB:P03966	0.546	0.548	5.509E-54	462	0.851	0.855	P03966.pdb.gz	MYCN_MOUSE N-myc proto-oncogene protein OS=Mus musculus OX=10090 GN=Mycn PE=2 SV=2
3	AFDB:Q9UL49	0.141	0.132	1.250E-6	500	0.188	0.174	Q9UL49.pdb.gz	TCFL5_HUMAN Transcription factor-like 5 protein OS=Homo sapiens OX=9606 GN=TCFL5 PE=2 SV=2
4	AFDB:Q8VIP2	0.192	0.105	3.020E-4	865	0.185	0.099	Q8VIP2.pdb.gz	MLXPL_RAT Carbohydrate-responsive element-binding protein OS=Rattus norvegicus OX=10116 GN=Mlxipl PE=1 SV=1
5	AFDB:O43019	0.172	0.103	2.543E-3	793	0.172	0.101	O43019.pdb.gz	SRE2_SCHPO Putative transcription factor sre2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sre2 PE=1 SV=1
6	AFDB:A0A087X1T2	0.189	0.143	4.262E-3	654	0.157	0.112	A0A087X1T2.pdb.gz	A0A087X1T2_HUMAN Sterol regulatory element binding transcription factor 2 OS=Homo sapiens OX=9606 GN=SREBF2 PE=1 SV=1
7	AFDB:Q00587	0.068	0.078	1.550E-2	391	0.125	0.148	Q00587.pdb.gz	BORG5_HUMAN Cdc42 effector protein 1 OS=Homo sapiens OX=9606 GN=CDC42EP1 PE=1 SV=1
8	AFDB:P41846	0.174	0.083	1.653E-2	1009	0.172	0.079	P41846.pdb.gz	WBS14_CAEEL Protein WBSCR14 homolog OS=Caenorhabditis elegans OX=6239 GN=mml-1 PE=1 SV=2
9	AFDB:Q9HAP2	0.189	0.097	1.653E-2	919	0.183	0.092	Q9HAP2.pdb.gz	MLXIP_HUMAN MLX-interacting protein OS=Homo sapiens OX=9606 GN=MLXIP PE=1 SV=2
10	AFDB:Q6A332	0.103	0.053	6.415E-2	1132	0.162	0.066	Q6A332.pdb.gz	ALY3_ARATH Protein ALWAYS EARLY 3 OS=Arabidopsis thaliana OX=3702 GN=ALY3 PE=1 SV=1
11	PDB:6wooL	0.049	0.105	3.467	198	0.037	0.086	6wooL.pdb.gz	An active role of the eukaryotic large ribosomal subunit in translation initiation fidelity.
12	PDB:5dgeSM	0.053	0.112	6.612	159	0.028	0.082	5dgeSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
13	PDB:6bk8K	0.071	0.296	6.612	82	0.022	0.122	6bk8K.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
14	PDB:3ojaA	0.147	0.142	7.053	482	0.022	0.021	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
15	PDB:5apnb	0.051	0.273	8.025	58	0.015	0.121	5apnb.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
16	PDB:7z0sC	0.056	0.046	8.025	604	0.034	0.026	7z0sC.pdb.gz	Structure of the membrane-bound formate hydrogenlyase complex from Escherichia coli.
17	PDB:2bskD	0.077	0.256	9.131	90	0.039	0.200	2bskD.pdb.gz
18	PDB:6ff4C	0.057	0.079	9.131	286	0.039	0.063	6ff4C.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P03966	0.0	726	462	0.851	0.855	MYCN_MOUSE N-myc proto-oncogene protein OS=Mus musculus OX=10090 GN=Mycn PE=2 SV=2
2	P04198	0.0	941	464	1.000	1.000	MYCN_HUMAN N-myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYCN PE=1 SV=2
3	A0A1W2PPD9	4.29e-131	380	253	0.405	0.743	A0A1W2PPD9_HUMAN MYCN proto-oncogene, bHLH transcription factor OS=Homo sapiens OX=9606 GN=MYCN PE=1 SV=1
4	Q7ZVS9	4.66e-73	237	396	0.373	0.437	MYCB_DANRE Transcriptional regulator Myc-B OS=Danio rerio OX=7955 GN=mycb PE=2 SV=1
5	Q28350	2.47e-69	229	439	0.392	0.415	MYC_CANLF Myc proto-oncogene protein OS=Canis lupus familiaris OX=9615 GN=MYC PE=2 SV=2
6	P09416	2.01e-67	224	439	0.386	0.408	MYC_RAT Myc proto-oncogene protein OS=Rattus norvegicus OX=10116 GN=Myc PE=1 SV=2
7	P01106	2.47e-63	213	439	0.386	0.408	MYC_HUMAN Myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=2
8	A0A060WAZ1	2.78e-62	209	406	0.366	0.419	A0A060WAZ1_ONCMY Transcriptional regulator OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00065805001 PE=4 SV=1
9	Q2L4Q4	2.82e-62	209	407	0.369	0.420	Q2L4Q4_ONCMY Transcriptional regulator OS=Oncorhynchus mykiss OX=8022 GN=myc PE=2 SV=1
10	P06646	1.68e-61	207	414	0.366	0.411	MYC_ONCMY Transcriptional regulator Myc (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=myc PE=3 SV=1
11	P01108	1.07e-35	139	439	0.188	0.198	MYC_MOUSE Myc proto-oncogene protein OS=Mus musculus OX=10090 GN=Myc PE=1 SV=2
12	A0A494C1T8	2.48e-35	136	339	0.164	0.224	A0A494C1T8_HUMAN Myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=1
13	P52160	9.01e-34	133	408	0.166	0.189	MYCA_DANRE Transcriptional regulator Myc-A OS=Danio rerio OX=7955 GN=myca PE=2 SV=3
14	P12524	7.85e-28	115	364	0.241	0.308	MYCL_HUMAN Protein L-Myc OS=Homo sapiens OX=9606 GN=MYCL PE=1 SV=2
15	P10166	1.87e-27	115	368	0.237	0.299	MYCL_MOUSE Protein L-Myc OS=Mus musculus OX=10090 GN=Mycl PE=2 SV=1
16	B2KUA9	6.83e-27	113	360	0.175	0.225	B2KUA9_DANRE Transcriptional regulator OS=Danio rerio OX=7955 GN=id:ibd5144 PE=2 SV=1
17	A0A0B4J1R1	5.41e-26	108	257	0.166	0.300	A0A0B4J1R1_HUMAN MYC proto-oncogene, bHLH transcription factor OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=1
18	P01109	2.56e-23	103	416	0.172	0.192	MYC_CHICK Myc proto-oncogene protein OS=Gallus gallus OX=9031 GN=MYC PE=1 SV=2
19	P12525	5.96e-23	102	358	0.170	0.221	MYCP1_HUMAN Putative myc-like protein MYCLP1 OS=Homo sapiens OX=9606 GN=MYCLP1 PE=5 SV=2
20	Q6P8Z1	4.01e-10	60.8	170	0.114	0.312	MYCB_MOUSE Protein B-Myc OS=Mus musculus OX=10090 GN=Mycb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09026 CENP-B_dimeris	3.4	19.5	Centromere protein B dimerisation domain
2	PF00010 HLH	3.9e-10	50.9	Helix-loop-helix DNA-binding domain
3	PF10422 LRS4	31	15.6	Monopolin complex subunit LRS4
4	PF01056 Myc_N	7.4e-128	438.7	Myc amino-terminal region
5	PF05793 TFIIF_alpha	1.9e+02	12.1	Transcription initiation factor IIF, alpha subunit (TFIIF-alpha)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281043

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216911	0.998	Aurora kinase A
2	9606.ENSP00000362649	0.959	Histone deacetylase 1
3	9606.ENSP00000320147	0.941	Histone-lysine N-methyltransferase EZH2
4	9606.ENSP00000430432	0.938	Histone deacetylase 2
5	9606.ENSP00000243346	0.936	N-myc-interactor
6	9606.ENSP00000351490	0.932	Protein max
7	9606.ENSP00000281708	0.851	F-box/WD repeat-containing protein 7
8	9606.ENSP00000418915	0.847	Cyclin-dependent kinase inhibitor 2A
9	9606.ENSP00000269305	0.837	Cellular tumor antigen p53
10	9606.ENSP00000159111	0.831	Lysine-specific demethylase 4B
11	9606.ENSP00000319169	0.831	Protein arginine N-methyltransferase 5
12	9606.ENSP00000404854	0.821	Protein NDRG1
13	9606.ENSP00000364885	0.811	Zinc finger and BTB domain-containing protein 17
14	9606.ENSP00000323588	0.796	Transcription factor SOX-2
15	9606.ENSP00000316578	0.773	Polycomb protein SUZ12
16	9606.ENSP00000329357	0.772	Transcription factor Sp1
17	9606.ENSP00000225983	0.770	Histone deacetylase 5
18	9606.ENSP00000351446	0.769	WD repeat-containing protein 5
19	9606.ENSP00000451712	0.758	Protein NDRG2
20	9606.ENSP00000247843	0.751	YEATS domain-containing protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	0.998	DNA-binding transcription factor activity
GO:0000977	0.998	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0019899	0.997	enzyme binding
GO:0000981	0.993	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.992	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.968	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0019900	0.873	kinase binding
GO:0008134	0.598	transcription factor binding
GO:0042802	0.460	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0019222	0.992	regulation of metabolic process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0045944	0.971	positive regulation of transcription by RNA polymerase II
GO:0009987	0.936	cellular process
GO:0009892	0.928	negative regulation of metabolic process
GO:0010605	0.838	negative regulation of macromolecule metabolic process
GO:0048523	0.770	negative regulation of cellular process
GO:0032502	0.515	developmental process
GO:0050896	0.510	response to stimulus
GO:0048856	0.508	anatomical structure development
GO:0032501	0.439	multicellular organismal process
GO:0031324	0.424	negative regulation of cellular metabolic process
GO:0051172	0.377	negative regulation of nitrogen compound metabolic process
GO:0008152	0.376	metabolic process
GO:0071704	0.344	organic substance metabolic process
GO:0042127	0.332	regulation of cell population proliferation
GO:0007275	0.330	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0005694	0.885	chromosome
GO:0032991	0.849	protein-containing complex
GO:0000785	0.763	chromatin
GO:0005730	0.750	nucleolus
GO:0005737	0.727	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]