StarFunc result for job id P04216

User Input

>input (161 residues)
MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKK
HVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNV
TVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04216	1.000	1.000	2.186E-28	161	1.000	1.000	P04216.pdb.gz	THY1_HUMAN Thy-1 membrane glycoprotein OS=Homo sapiens OX=9606 GN=THY1 PE=1 SV=2
2	AFDB:P01830	0.924	0.924	8.961E-22	161	0.708	0.708	P01830.pdb.gz	THY1_RAT Thy-1 membrane glycoprotein OS=Rattus norvegicus OX=10116 GN=Thy1 PE=1 SV=1
3	AFDB:P01831	0.856	0.852	2.807E-21	162	0.696	0.691	P01831.pdb.gz	THY1_MOUSE Thy-1 membrane glycoprotein OS=Mus musculus OX=10090 GN=Thy1 PE=1 SV=1
4	PDB:5ir3A	0.522	0.727	6.546E-6	111	0.087	0.126	5ir3A.pdb.gz
5	AFDB:P09793	0.447	0.337	7.830E-6	223	0.130	0.094	P09793.pdb.gz	CTLA4_MOUSE Cytotoxic T-lymphocyte protein 4 OS=Mus musculus OX=10090 GN=Ctla4 PE=1 SV=1
6	AFDB:E7F7T2	0.582	0.388	1.028E-5	264	0.143	0.087	E7F7T2.pdb.gz	E7F7T2_DANRE Myelin protein zero-like 1 like OS=Danio rerio OX=7955 GN=zgc:110608 PE=1 SV=1
7	AFDB:Q6NZ26	0.561	0.168	1.146E-5	615	0.186	0.049	Q6NZ26.pdb.gz
8	AFDB:A0A096MJE4	0.476	0.356	1.277E-5	223	0.143	0.103	A0A096MJE4.pdb.gz	A0A096MJE4_RAT Cytotoxic T-lymphocyte protein 4 OS=Rattus norvegicus OX=10116 GN=Ctla4 PE=4 SV=1
9	AFDB:Q16653	0.544	0.374	1.424E-5	247	0.211	0.138	Q16653.pdb.gz	MOG_HUMAN Myelin-oligodendrocyte glycoprotein OS=Homo sapiens OX=9606 GN=MOG PE=1 SV=2
10	AFDB:O95976	0.489	0.343	1.504E-5	241	0.186	0.124	O95976.pdb.gz	IGSF6_HUMAN Immunoglobulin superfamily member 6 OS=Homo sapiens OX=9606 GN=IGSF6 PE=2 SV=2
11	AFDB:Q96GW7	0.496	0.099	1.588E-5	911	0.168	0.030	Q96GW7.pdb.gz	PGCB_HUMAN Brevican core protein OS=Homo sapiens OX=9606 GN=BCAN PE=1 SV=2
12	PDB:2cd0A	0.459	0.637	3.001E-5	111	0.087	0.126	2cd0A.pdb.gz
13	PDB:6sm1A	0.471	0.649	3.168E-5	111	0.118	0.171	6sm1A.pdb.gz	Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation.
14	PDB:1cd0A	0.503	0.696	3.346E-5	111	0.081	0.117	1cd0A.pdb.gz
15	PDB:3zhlA	0.493	0.627	4.158E-5	121	0.130	0.174	3zhlA.pdb.gz
16	PDB:4aizA	0.483	0.687	5.458E-5	107	0.075	0.112	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.
17	PDB:6hd8A	0.464	0.182	8.432E-5	461	0.112	0.039	6hd8A.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.
18	PDB:6rulA	0.450	0.275	9.927E-5	276	0.087	0.051	6rulA.pdb.gz	Chemogenetic Control of Nanobodies.
19	PDB:1ohqA	0.538	0.699	1.048E-4	120	0.112	0.150	1ohqA.pdb.gz
20	PDB:1f6lL	0.458	0.660	1.169E-4	106	0.112	0.170	1f6lL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P04216	1.67e-116	328	161	1.000	1.000	THY1_HUMAN Thy-1 membrane glycoprotein OS=Homo sapiens OX=9606 GN=THY1 PE=1 SV=2
2	P01830	9.89e-71	212	161	0.708	0.708	THY1_RAT Thy-1 membrane glycoprotein OS=Rattus norvegicus OX=10116 GN=Thy1 PE=1 SV=1
3	P01831	1.41e-68	206	162	0.702	0.698	THY1_MOUSE Thy-1 membrane glycoprotein OS=Mus musculus OX=10090 GN=Thy1 PE=1 SV=1
4	Q9JHY1	0.25	33.5	300	0.174	0.093	JAM1_RAT Junctional adhesion molecule A OS=Rattus norvegicus OX=10116 GN=F11r PE=1 SV=1
5	A0A024R0K5	1.0	32.0	702	0.149	0.034	A0A024R0K5_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=1
6	P06731	1.0	32.0	702	0.149	0.034	CEAM5_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=4
7	P17790	1.1	31.6	388	0.130	0.054	BASI_CHICK Basigin OS=Gallus gallus OX=9031 GN=BSG PE=1 SV=2
8	A0A087WYX0	1.2	31.6	524	0.149	0.046	A0A087WYX0_HUMAN CEA cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=1
9	Q62151	1.3	31.6	402	0.093	0.037	RAGE_MOUSE Advanced glycosylation end product-specific receptor OS=Mus musculus OX=10090 GN=Ager PE=1 SV=2
10	O88792	1.6	31.2	300	0.161	0.087	JAM1_MOUSE Junctional adhesion molecule A OS=Mus musculus OX=10090 GN=F11r PE=1 SV=2
11	Q03142	2.0	31.2	799	0.186	0.038	FGFR4_MOUSE Fibroblast growth factor receptor 4 OS=Mus musculus OX=10090 GN=Fgfr4 PE=1 SV=3
12	Q5NV82	2.3	29.6	104	0.124	0.192	Q5NV82_HUMAN V4-2 protein (Fragment) OS=Homo sapiens OX=9606 GN=V4-2 PE=4 SV=1
13	Q498D6	2.5	30.8	800	0.180	0.036	FGFR4_RAT Fibroblast growth factor receptor 4 OS=Rattus norvegicus OX=10116 GN=Fgfr4 PE=1 SV=1
14	Q8MYR8	3.4	30.4	576	0.099	0.028	Q8MYR8_DROME RH74685p OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
15	Q9GV82	3.7	30.0	536	0.099	0.030	Q9GV82_DROME Stretchin-MLCK (Fragment) OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
16	A1ZA72	4.2	30.0	7944	0.099	0.002	A1ZA72_DROME Stretchin-Mlck, isoform V OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=2
17	Q7Z553	4.2	30.0	956	0.124	0.021	MDGA2_HUMAN MAM domain-containing glycosylphosphatidylinositol anchor protein 2 OS=Homo sapiens OX=9606 GN=MDGA2 PE=1 SV=2
18	A0A0B4JD82	4.3	30.0	7905	0.099	0.002	A0A0B4JD82_DROME Stretchin-Mlck, isoform T OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=1
19	A0A0B4KF84	4.4	30.0	8216	0.099	0.002	A0A0B4KF84_DROME Stretchin-Mlck, isoform S OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=1
20	A0A0B4KG35	4.4	30.0	8255	0.099	0.002	A0A0B4KG35_DROME Stretchin-Mlck, isoform U OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	1.2e+02	14.2	Immunoglobulin I-set domain
2	PF00047 ig	6.2e-12	56.9	Immunoglobulin domain
3	PF13895 Ig_2	2e+02	13.7	Immunoglobulin domain
4	PF13927 Ig_3	0.62	22.0	Immunoglobulin domain
5	PF16706 Izumo-Ig	3e+02	12.8	Izumo-like Immunoglobulin domain
6	PF07686 V-set	0.12	23.9	Immunoglobulin V-set domain
7	PF02928 zf-C5HC2	2.9e+02	13.2	C5HC2 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284240

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361818	0.998	Syndecan-4
2	9606.ENSP00000441691	0.991	Integrin alpha-M
3	9606.ENSP00000261023	0.968	Integrin alpha-V
4	9606.ENSP00000452786	0.963	Integrin beta-3
5	9606.ENSP00000380948	0.941	Integrin beta-2
6	9606.ENSP00000362680	0.927	Proto-oncogene tyrosine-protein kinase Src
7	9606.ENSP00000310036	0.922	Hematopoietic progenitor cell antigen CD34
8	9606.ENSP00000362299	0.922	Endoglin
9	9606.ENSP00000257770	0.918	5'-nucleotidase
10	9606.ENSP00000411355	0.918	Receptor-type tyrosine-protein phosphatase C
11	9606.ENSP00000398632	0.894	CD44 antigen
12	9606.ENSP00000379350	0.892	Integrin beta-1
13	9606.ENSP00000264036	0.868	Cell surface glycoprotein MUC18
14	9606.ENSP00000305988	0.865	CD166 antigen
15	9606.ENSP00000457421	0.859	Platelet endothelial cell adhesion molecule
16	9606.ENSP00000426809	0.833	Prominin-1
17	9606.ENSP00000385720	0.831	Rho GTPase-activating protein 35
18	9606.ENSP00000437940	0.823	B-lymphocyte antigen CD19
19	9606.ENSP00000300060	0.808	Aminopeptidase N
20	9606.ENSP00000371897	0.804	Rho GTPase-activating protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005178	0.998	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0048522	0.996	positive regulation of cellular process
GO:0010810	0.996	regulation of cell-substrate adhesion
GO:0050896	0.995	response to stimulus
GO:0002682	0.994	regulation of immune system process
GO:0051128	0.994	regulation of cellular component organization
GO:0007165	0.987	signal transduction
GO:0045785	0.981	positive regulation of cell adhesion
GO:0007166	0.976	cell surface receptor signaling pathway
GO:2000145	0.969	regulation of cell motility
GO:0030334	0.963	regulation of cell migration
GO:0001952	0.939	regulation of cell-matrix adhesion
GO:0051130	0.935	positive regulation of cellular component organization
GO:0010811	0.935	positive regulation of cell-substrate adhesion
GO:1901888	0.934	regulation of cell junction assembly
GO:0150116	0.932	regulation of cell-substrate junction organization
GO:0030335	0.930	positive regulation of cell migration
GO:0001954	0.911	positive regulation of cell-matrix adhesion
GO:0007229	0.910	integrin-mediated signaling pathway
GO:0022407	0.883	regulation of cell-cell adhesion
GO:0002684	0.875	positive regulation of immune system process
GO:0044089	0.843	positive regulation of cellular component biogenesis
GO:0022409	0.811	positive regulation of cell-cell adhesion
GO:0002685	0.756	regulation of leukocyte migration
GO:1901890	0.722	positive regulation of cell junction assembly
GO:0019222	0.691	regulation of metabolic process
GO:0032502	0.685	developmental process
GO:0032501	0.673	multicellular organismal process
GO:0090109	0.661	regulation of cell-substrate junction assembly
GO:0060255	0.658	regulation of macromolecule metabolic process
GO:0051893	0.630	regulation of focal adhesion assembly
GO:0048856	0.627	anatomical structure development
GO:0048519	0.600	negative regulation of biological process
GO:0002691	0.594	regulation of cellular extravasation
GO:0080090	0.567	regulation of primary metabolic process
GO:0048583	0.565	regulation of response to stimulus
GO:0048523	0.553	negative regulation of cellular process
GO:0031323	0.553	regulation of cellular metabolic process
GO:0051171	0.509	regulation of nitrogen compound metabolic process
GO:0007275	0.486	multicellular organism development
GO:0042325	0.466	regulation of phosphorylation
GO:0051239	0.453	regulation of multicellular organismal process
GO:0031399	0.440	regulation of protein modification process
GO:0065009	0.417	regulation of molecular function
GO:0048584	0.415	positive regulation of response to stimulus
GO:0050790	0.397	regulation of catalytic activity
GO:0050793	0.392	regulation of developmental process
GO:0023051	0.377	regulation of signaling
GO:0010646	0.377	regulation of cell communication
GO:0009893	0.372	positive regulation of metabolic process
GO:0009966	0.370	regulation of signal transduction
GO:0001932	0.361	regulation of protein phosphorylation
GO:0008152	0.346	metabolic process
GO:0030154	0.340	cell differentiation
GO:0002687	0.340	positive regulation of leukocyte migration
GO:0002376	0.309	immune system process
GO:0010604	0.309	positive regulation of macromolecule metabolic process
GO:0048585	0.307	negative regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0009986	0.997	cell surface
GO:0005737	0.995	cytoplasm
GO:0012505	0.990	endomembrane system
GO:0043227	0.984	membrane-bounded organelle
GO:0043231	0.966	intracellular membrane-bounded organelle
GO:0005576	0.945	extracellular region
GO:0031982	0.932	vesicle
GO:0005615	0.888	extracellular space
GO:0043230	0.802	extracellular organelle
GO:0065010	0.786	extracellular membrane-bounded organelle
GO:1903561	0.774	extracellular vesicle
GO:0070062	0.722	extracellular exosome
GO:0098590	0.691	plasma membrane region
GO:0005829	0.605	cytosol
GO:0030055	0.465	cell-substrate junction
GO:0120025	0.460	plasma membrane bounded cell projection
GO:0005925	0.448	focal adhesion
GO:0005783	0.441	endoplasmic reticulum
GO:0097708	0.430	intracellular vesicle
GO:0031410	0.424	cytoplasmic vesicle
GO:0045121	0.328	membrane raft

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]