StarFunc result for job id P04217

User Input

>input (495 residues)
MSMLVVFLLLWGVTWGPVTEAAIFYETQPSLWAESESLLKPLANVTLTCQAHLETPDFQL
FKNGVAQEPVHLDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPW
LSMAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPGNY
SCSYRTDGEGALSEPSATVTIEELAAPPPPVLMHHGESSQVLHPGNKVTLTCVAPLSGVD
FQLRRGEKELLVPRSSTSPDRIFFHLNAVALGDGGHYTCRYRLHDNQNGWSGDSAPVELI
LSDETLPAPEFSPEPESGRALRLRCLAPLEGARFALVREDRGGRRVHRFQSPAGTEALFE
LHNISVADSANYSCVYVDLKPPFGGSAPSERLELHVDGPPPRPQLRATWSGAVLAGRDAV
LRCEGPIPDVTFELLREGETKAVKTVRTPGAAANLELIFVGPQHAGNYRCRYRSWVPHTF
ESELSDPVELLVAES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04217	1.000	1.000	2.154E-84	495	1.000	1.000	P04217.pdb.gz	A1BG_HUMAN Alpha-1B-glycoprotein OS=Homo sapiens OX=9606 GN=A1BG PE=1 SV=4
2	AFDB:Q925N6	0.350	0.137	5.322E-31	1320	0.317	0.119	Q925N6.pdb.gz	IGSF1_RAT Immunoglobulin superfamily member 1 OS=Rattus norvegicus OX=10116 GN=Igsf1 PE=1 SV=1
3	AFDB:Q8N6C5	0.351	0.138	5.191E-30	1336	0.321	0.119	Q8N6C5.pdb.gz	IGSF1_HUMAN Immunoglobulin superfamily member 1 OS=Homo sapiens OX=9606 GN=IGSF1 PE=1 SV=3
4	AFDB:P97484	0.272	0.168	2.604E-21	841	0.218	0.128	P97484.pdb.gz	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
5	AFDB:Q96RD9	0.200	0.114	8.322E-21	977	0.238	0.121	Q96RD9.pdb.gz	FCRL5_HUMAN Fc receptor-like protein 5 OS=Homo sapiens OX=9606 GN=FCRL5 PE=1 SV=3
6	AFDB:P59901	0.299	0.297	3.763E-19	499	0.206	0.204	P59901.pdb.gz	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
7	AFDB:O75023	0.192	0.163	5.081E-18	590	0.214	0.180	O75023.pdb.gz	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
8	AFDB:O75022	0.317	0.256	5.323E-18	631	0.204	0.160	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
9	AFDB:Q8N149	0.331	0.339	9.298E-18	483	0.212	0.217	Q8N149.pdb.gz	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
10	AFDB:P51866	0.198	0.143	1.229E-17	739	0.170	0.114	P51866.pdb.gz	PECA1_BOVIN Platelet endothelial cell adhesion molecule OS=Bos taurus OX=9913 GN=PECAM1 PE=1 SV=1
11	PDB:1e07A	0.180	0.147	4.578E-13	642	0.152	0.117	1e07A.pdb.gz
12	PDB:5oj2B	0.171	0.134	1.839E-10	692	0.176	0.126	5oj2B.pdb.gz
13	PDB:2rcjC	0.149	0.143	9.358E-10	523	0.164	0.155	2rcjC.pdb.gz
14	PDB:7q1yA	0.262	0.128	4.761E-9	1374	0.111	0.040	7q1yA.pdb.gz
15	PDB:7vonA	0.254	0.125	1.264E-8	1399	0.117	0.041	7vonA.pdb.gz
16	PDB:6h03A	0.185	0.095	1.453E-8	1223	0.125	0.051	6h03A.pdb.gz
17	PDB:4rtdA	0.164	0.102	1.833E-8	1122	0.145	0.064	4rtdA.pdb.gz
18	PDB:7nycA	0.171	0.077	5.096E-8	1542	0.133	0.043	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:5a42A	0.164	0.066	5.338E-8	1597	0.149	0.046	5a42A.pdb.gz
20	PDB:7q5zA	0.160	0.079	5.338E-8	1344	0.141	0.052	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P04217	0.0	1007	495	1.000	1.000	A1BG_HUMAN Alpha-1B-glycoprotein OS=Homo sapiens OX=9606 GN=A1BG PE=1 SV=4
2	Q925N6	9.18e-50	186	1320	0.329	0.123	IGSF1_RAT Immunoglobulin superfamily member 1 OS=Rattus norvegicus OX=10116 GN=Igsf1 PE=1 SV=1
3	Q8N6C5	2.25e-49	184	1336	0.323	0.120	IGSF1_HUMAN Immunoglobulin superfamily member 1 OS=Homo sapiens OX=9606 GN=IGSF1 PE=1 SV=3
4	O75022	8.20e-25	110	631	0.242	0.190	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
5	Q8N423	3.96e-24	108	597	0.238	0.198	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
6	P59901	6.51e-23	103	499	0.224	0.222	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
7	O75019	9.71e-23	103	489	0.236	0.239	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
8	Q8N149	3.08e-21	98.6	483	0.220	0.226	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
9	O75023	6.08e-21	98.2	590	0.244	0.205	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
10	Q8NHL6	6.81e-18	89.0	650	0.228	0.174	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
11	Q8N6C8	1.14e-17	87.4	439	0.218	0.246	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
12	B6A8C7	2.09e-16	81.6	271	0.158	0.288	TARM1_HUMAN T-cell-interacting, activating receptor on myeloid cells protein 1 OS=Homo sapiens OX=9606 GN=TARM1 PE=1 SV=2
13	Q8K4V6	1.06e-14	79.3	697	0.164	0.116	Q8K4V6_MOUSE Paired immunoglobulin-like receptor B (Fragment) OS=Mus musculus OX=10090 GN=Pirb PE=1 SV=1
14	A6NI73	1.73e-13	73.2	299	0.117	0.194	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
15	Q8N743	3.22e-13	73.6	410	0.172	0.207	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
16	Q8VBT3	1.08e-12	70.5	265	0.137	0.257	OSCAR_MOUSE Osteoclast-associated immunoglobulin-like receptor OS=Mus musculus OX=10090 GN=Oscar PE=2 SV=1
17	P97484	1.12e-12	72.8	841	0.166	0.098	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
18	B6A8R8	1.47e-12	70.5	288	0.125	0.215	TARM1_MOUSE T-cell-interacting, activating receptor on myeloid cells protein 1 OS=Mus musculus OX=10090 GN=Tarm1 PE=2 SV=1
19	Q8IYS5	2.09e-12	69.7	282	0.133	0.234	OSCAR_HUMAN Osteoclast-associated immunoglobulin-like receptor OS=Homo sapiens OX=9606 GN=OSCAR PE=1 SV=3
20	P43629	4.26e-12	70.5	444	0.158	0.176	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	60	15.1	Immunoglobulin I-set domain
2	PF00047 ig	3.2e-06	38.5	Immunoglobulin domain
3	PF13895 Ig_2	6.6e-32	121.0	Immunoglobulin domain
4	PF13927 Ig_3	1.4e-13	62.5	Immunoglobulin domain
5	PF16706 Izumo-Ig	17	16.8	Izumo-like Immunoglobulin domain
6	PF17802 SpaA	16	16.9	Prealbumin-like fold domain
7	PF07686 V-set	1.5	20.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263100

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340944	0.998	Tyrosine-protein phosphatase non-receptor type 11
2	9606.ENSP00000376345	0.996	Growth factor receptor-bound protein 2
3	9606.ENSP00000389026	0.980	Cysteine rich secretory protein family
4	9606.ENSP00000354952	0.972	GRB2-associated-binding protein 2
5	9606.ENSP00000262995	0.944	GRB2-associated-binding protein 1
6	9606.ENSP00000451828	0.929	RAC-alpha serine/threonine-protein kinase
7	9606.ENSP00000385675	0.913	Interleukin-6
8	9606.ENSP00000428056	0.909	Phosphatidylinositol 3-kinase regulatory subunit alpha
9	9606.ENSP00000444986	0.909	Tyrosine-protein kinase HCK
10	9606.ENSP00000263967	0.908	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
11	9606.ENSP00000387784	0.902	Son of sevenless homolog 1
12	9606.ENSP00000343204	0.900	Tyrosine-protein kinase JAK1
13	9606.ENSP00000357470	0.900	Interleukin-6 receptor subunit alpha
14	9606.ENSP00000359575	0.900	LIM domain transcription factor LMO4
15	9606.ENSP00000370698	0.900	Interleukin-6 receptor subunit beta
16	9606.ENSP00000399588	0.736	GRB2-associated-binding protein 3
17	9606.ENSP00000338276	0.695	Cysteine-rich secretory protein 1
18	9606.ENSP00000393887	0.663	Alpha-2-HS-glycoprotein
19	9606.ENSP00000421725	0.639	Vitamin D-binding protein
20	9606.ENSP00000348170	0.621	Haptoglobin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.669	signaling receptor binding
GO:0042802	0.503	identical protein binding
GO:0060089	0.496	molecular transducer activity
GO:0038023	0.487	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0009987	0.973	cellular process
GO:0048519	0.970	negative regulation of biological process
GO:0050896	0.916	response to stimulus
GO:0048583	0.870	regulation of response to stimulus
GO:0048523	0.823	negative regulation of cellular process
GO:0048518	0.807	positive regulation of biological process
GO:0023051	0.557	regulation of signaling
GO:0010646	0.557	regulation of cell communication
GO:0019222	0.502	regulation of metabolic process
GO:0009966	0.489	regulation of signal transduction
GO:0048522	0.482	positive regulation of cellular process
GO:0032502	0.465	developmental process
GO:0051239	0.439	regulation of multicellular organismal process
GO:0048856	0.424	anatomical structure development
GO:0060255	0.413	regulation of macromolecule metabolic process
GO:0080090	0.410	regulation of primary metabolic process
GO:0051716	0.384	cellular response to stimulus
GO:0031323	0.383	regulation of cellular metabolic process
GO:0032501	0.382	multicellular organismal process
GO:0051171	0.362	regulation of nitrogen compound metabolic process
GO:0007154	0.361	cell communication
GO:0007165	0.353	signal transduction
GO:0010468	0.300	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0005737	0.998	cytoplasm
GO:0031982	0.998	vesicle
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0005615	0.997	extracellular space
GO:0070013	0.996	intracellular organelle lumen
GO:0030141	0.990	secretory granule
GO:0031983	0.985	vesicle lumen
GO:0034774	0.979	secretory granule lumen
GO:0043230	0.977	extracellular organelle
GO:0062023	0.977	collagen-containing extracellular matrix
GO:0072562	0.973	blood microparticle
GO:0065010	0.959	extracellular membrane-bounded organelle
GO:0016020	0.950	membrane
GO:0070062	0.942	extracellular exosome
GO:0031091	0.855	platelet alpha granule
GO:0031093	0.696	platelet alpha granule lumen
GO:0005886	0.561	plasma membrane
GO:0101002	0.545	ficolin-1-rich granule
GO:1904813	0.456	ficolin-1-rich granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]