StarFunc result for job id P04233

User Input

>input (296 residues)
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLL
LAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPM
GALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKV
FESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLP
LQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04233	1.000	1.000	1.690E-51	296	1.000	1.000	P04233.pdb.gz	HG2A_HUMAN HLA class II histocompatibility antigen gamma chain OS=Homo sapiens OX=9606 GN=CD74 PE=1 SV=3
2	AFDB:P10247	0.441	0.462	4.037E-38	280	0.730	0.771	P10247.pdb.gz	HG2A_RAT H-2 class II histocompatibility antigen gamma chain OS=Rattus norvegicus OX=10116 GN=Cd74 PE=1 SV=2
3	AFDB:P04441	0.485	0.508	8.863E-38	279	0.726	0.771	P04441.pdb.gz	HG2A_MOUSE H-2 class II histocompatibility antigen gamma chain OS=Mus musculus OX=10090 GN=Cd74 PE=1 SV=3
4	AFDB:E1B279	0.407	0.420	5.707E-25	285	0.416	0.432	E1B279.pdb.gz	E1B279_COTJA Invariant chain isoform CIi2-Ii OS=Coturnix japonica OX=93934 GN=Ii2 PE=2 SV=1
5	AFDB:Q9BD54	0.566	0.580	2.413E-24	288	0.426	0.438	Q9BD54.pdb.gz	Q9BD54_CHICK MHC class II-associated invariant chain (Fragment) OS=Gallus gallus OX=9031 GN=CD74 PE=2 SV=2
6	AFDB:Q764N1	0.253	0.341	5.119E-20	214	0.568	0.785	Q764N1.pdb.gz	Q764N1_PIG CD74 antigen OS=Sus scrofa OX=9823 GN=cd74 PE=2 SV=1
7	AFDB:A1L1X6	0.220	0.315	2.101E-8	198	0.216	0.323	A1L1X6.pdb.gz
8	AFDB:Q92563	0.235	0.168	7.113E-5	424	0.155	0.108	Q92563.pdb.gz	TICN2_HUMAN Testican-2 OS=Homo sapiens OX=9606 GN=SPOCK2 PE=1 SV=1
9	AFDB:Q8BKV0	0.168	0.116	7.595E-5	436	0.111	0.076	Q8BKV0.pdb.gz	TICN3_MOUSE Testican-3 OS=Mus musculus OX=10090 GN=Spock3 PE=2 SV=2
10	AFDB:Q9VCR3	0.216	0.106	1.370E-4	629	0.209	0.099	Q9VCR3.pdb.gz	COW_DROME Proteoglycan Cow OS=Drosophila melanogaster OX=7227 GN=Cow PE=1 SV=3
11	PDB:7y4sA	0.139	0.124	3.769	343	0.098	0.085	7y4sA.pdb.gz
12	PDB:4jbwF	0.083	0.052	4.297	492	0.020	0.012	4jbwF.pdb.gz
13	PDB:5ur9F	0.069	0.127	4.297	138	0.014	0.029	5ur9F.pdb.gz	The Antinociceptive Agent SBFI-26 Binds to Anandamide Transporters FABP5 and FABP7 at Two Different Sites.
14	PDB:7o9k6	0.078	0.072	4.297	331	0.041	0.036	7o9k6.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
15	PDB:4n78D	0.134	0.169	4.588	202	0.074	0.109	4n78D.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
16	PDB:7ajtJM	0.077	0.144	4.588	135	0.071	0.156	7ajtJM.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:2rvqD	0.080	0.144	4.899	129	0.044	0.101	2rvqD.pdb.gz
18	PDB:6fvbA	0.102	0.034	4.899	1001	0.051	0.015	6fvbA.pdb.gz
19	PDB:2qo5A	0.067	0.121	5.963	129	0.017	0.039	2qo5A.pdb.gz
20	PDB:7aavv	0.092	0.122	6.367	206	0.074	0.107	7aavv.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P04233	0.0	617	296	1.000	1.000	HG2A_HUMAN HLA class II histocompatibility antigen gamma chain OS=Homo sapiens OX=9606 GN=CD74 PE=1 SV=3
2	P10247	1.37e-162	455	280	0.733	0.775	HG2A_RAT H-2 class II histocompatibility antigen gamma chain OS=Rattus norvegicus OX=10116 GN=Cd74 PE=1 SV=2
3	P04441	5.73e-161	451	279	0.726	0.771	HG2A_MOUSE H-2 class II histocompatibility antigen gamma chain OS=Mus musculus OX=10090 GN=Cd74 PE=1 SV=3
4	Q764N1	2.33e-107	312	214	0.507	0.701	Q764N1_PIG CD74 antigen OS=Sus scrofa OX=9823 GN=cd74 PE=2 SV=1
5	Q6J613	5.27e-78	240	286	0.426	0.441	Q6J613_CHICK Invariant chain isoform p41 OS=Gallus gallus OX=9031 GN=Ii PE=1 SV=1
6	Q9BD54	2.13e-77	239	288	0.422	0.434	Q9BD54_CHICK MHC class II-associated invariant chain (Fragment) OS=Gallus gallus OX=9031 GN=CD74 PE=2 SV=2
7	E1B279	3.08e-70	221	285	0.405	0.421	E1B279_COTJA Invariant chain isoform CIi2-Ii OS=Coturnix japonica OX=93934 GN=Ii2 PE=2 SV=1
8	D6QUQ3	3.90e-39	139	222	0.270	0.360	D6QUQ3_COTJA Invariant chain OS=Coturnix japonica OX=93934 GN=Ii PE=2 SV=1
9	Q9PUT2	1.49e-25	103	237	0.253	0.316	Q9PUT2_DANRE CD74 molecule, major histocompatibility complex, class II invariant chain a OS=Danio rerio OX=7955 GN=iclp1 PE=2 SV=1
10	Q9PVD9	4.57e-13	68.9	198	0.098	0.146	Q9PVD9_DANRE CD74 molecule, major histocompatibility complex, class II invariant chain b OS=Danio rerio OX=7955 GN=iclp2 PE=2 SV=1
11	Q14112	9.70e-12	67.8	1375	0.105	0.023	NID2_HUMAN Nidogen-2 OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=3
12	P14543	1.26e-11	67.4	1247	0.105	0.025	NID1_HUMAN Nidogen-1 OS=Homo sapiens OX=9606 GN=NID1 PE=1 SV=3
13	Q8IV28	1.44e-11	67.0	969	0.105	0.032	Q8IV28_HUMAN NID2 protein OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=1
14	A0A4X1WD80	1.56e-11	67.0	1348	0.098	0.022	A0A4X1WD80_PIG Nidogen 2 OS=Sus scrofa OX=9823 GN=NID2 PE=4 SV=1
15	F1RGY5	3.86e-11	65.9	1309	0.111	0.025	F1RGY5_PIG Nidogen 1 OS=Sus scrofa OX=9823 GN=NID1 PE=1 SV=4
16	O88322	4.93e-10	62.8	1403	0.088	0.019	NID2_MOUSE Nidogen-2 OS=Mus musculus OX=10090 GN=Nid2 PE=1 SV=2
17	Q9VCR3	6.44e-10	62.0	629	0.084	0.040	COW_DROME Proteoglycan Cow OS=Drosophila melanogaster OX=7227 GN=Cow PE=1 SV=3
18	B5DFC9	1.15e-09	61.6	1396	0.088	0.019	NID2_RAT Nidogen-2 OS=Rattus norvegicus OX=10116 GN=Nid2 PE=2 SV=1
19	Q9BQ16	2.23e-09	60.1	436	0.108	0.073	TICN3_HUMAN Testican-3 OS=Homo sapiens OX=9606 GN=SPOCK3 PE=1 SV=2
20	Q62288	6.79e-09	58.5	442	0.128	0.086	TICN1_MOUSE Testican-1 OS=Mus musculus OX=10090 GN=Spock1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09307 MHC2-interact	1e-38	143.0	CLIP, MHC2 interacting
2	PF08831 MHCassoc_trimer	3.3e-29	112.1	Class II MHC-associated invariant chain trimerisation domain
3	PF00086 Thyroglobulin_1	1.3e-11	55.2	Thyroglobulin type-1 repeat
4	PF12841 YvrJ	5.9e+02	11.5	YvrJ protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000009530

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378786	0.999	HLA class II histocompatibility antigen, DR alpha chain
2	9606.ENSP00000398632	0.998	CD44 antigen
3	9606.ENSP00000215754	0.996	Macrophage migration inhibitory factor
4	9606.ENSP00000353099	0.994	HLA class II histocompatibility antigen, DRB1-15 beta chain
5	9606.ENSP00000363976	0.994	HLA class II histocompatibility antigen, DM alpha chain
6	9606.ENSP00000345344	0.992	Cathepsin L1
7	9606.ENSP00000319635	0.991	C-X-C chemokine receptor type 2
8	9606.ENSP00000386884	0.991	C-X-C chemokine receptor type 4
9	9606.ENSP00000398890	0.985	HLA class II histocompatibility antigen, DM beta chain
10	9606.ENSP00000339398	0.984	Major histocompatibility complex, class II, DQ alpha 1
11	9606.ENSP00000357981	0.984	Cathepsin S
12	9606.ENSP00000393566	0.980	HLA class II histocompatibility antigen, DP alpha 1 chain
13	9606.ENSP00000381386	0.978	D-dopachrome decarboxylase
14	9606.ENSP00000390431	0.973	Major histocompatibility complex, class II, DQ beta 2
15	9606.ENSP00000364080	0.969	HLA class II histocompatibility antigen, DQ beta 1 chain
16	9606.ENSP00000350911	0.951	Cathepsin E
17	9606.ENSP00000229829	0.947	HLA class II histocompatibility antigen, DO alpha chain
18	9606.ENSP00000364114	0.945	HLA class II histocompatibility antigen, DR beta 5 chain
19	9606.ENSP00000236671	0.938	Cathepsin D
20	9606.ENSP00000390020	0.938	HLA class II histocompatibility antigen, DO beta chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019955	1.000	cytokine binding
GO:0042287	1.000	MHC protein binding
GO:0038023	0.998	signaling receptor activity
GO:0004888	0.974	transmembrane signaling receptor activity
GO:0140375	0.930	immune receptor activity
GO:0004896	0.920	cytokine receptor activity
GO:0042802	0.919	identical protein binding
GO:0033218	0.805	amide binding
GO:0044877	0.788	protein-containing complex binding
GO:0042277	0.787	peptide binding
GO:0044183	0.744	protein folding chaperone
GO:0001540	0.736	amyloid-beta binding
GO:0023023	0.716	MHC protein complex binding
GO:0042289	0.673	MHC class II protein binding
GO:0035718	0.601	macrophage migration inhibitory factor binding
GO:0042658	0.316	MHC class II protein binding, via antigen binding groove
GO:0042609	0.300	CD4 receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.983	regulation of cellular process
GO:0050896	0.980	response to stimulus
GO:0009987	0.978	cellular process
GO:0048518	0.975	positive regulation of biological process
GO:1902533	0.957	positive regulation of intracellular signal transduction
GO:0043410	0.941	positive regulation of MAPK cascade
GO:0002694	0.919	regulation of leukocyte activation
GO:0002684	0.914	positive regulation of immune system process
GO:1902105	0.908	regulation of leukocyte differentiation
GO:0002376	0.906	immune system process
GO:0032722	0.906	positive regulation of chemokine production
GO:2001243	0.902	negative regulation of intrinsic apoptotic signaling pathway
GO:0006955	0.901	immune response
GO:0070372	0.897	regulation of ERK1 and ERK2 cascade
GO:1902253	0.881	regulation of intrinsic apoptotic signaling pathway by p53 class mediator
GO:1901797	0.881	negative regulation of signal transduction by p53 class mediator
GO:0080090	0.876	regulation of primary metabolic process
GO:0051171	0.868	regulation of nitrogen compound metabolic process
GO:2001020	0.867	regulation of response to DNA damage stimulus
GO:0006952	0.866	defense response
GO:0031323	0.865	regulation of cellular metabolic process
GO:0032103	0.865	positive regulation of response to external stimulus
GO:0051249	0.861	regulation of lymphocyte activation
GO:0008152	0.832	metabolic process
GO:0042221	0.827	response to chemical
GO:0009607	0.820	response to biotic stimulus
GO:0051246	0.819	regulation of protein metabolic process
GO:0051251	0.817	positive regulation of lymphocyte activation
GO:0051716	0.814	cellular response to stimulus
GO:0051173	0.813	positive regulation of nitrogen compound metabolic process
GO:0010033	0.812	response to organic substance
GO:0044419	0.808	biological process involved in interspecies interaction between organisms
GO:0042327	0.805	positive regulation of phosphorylation
GO:0009605	0.796	response to external stimulus
GO:0051707	0.785	response to other organism
GO:0034097	0.780	response to cytokine
GO:0051247	0.777	positive regulation of protein metabolic process
GO:0001932	0.763	regulation of protein phosphorylation
GO:0030334	0.756	regulation of cell migration
GO:0007154	0.750	cell communication
GO:0023052	0.742	signaling
GO:0070374	0.715	positive regulation of ERK1 and ERK2 cascade
GO:0071704	0.694	organic substance metabolic process
GO:0070887	0.694	cellular response to chemical stimulus
GO:0042127	0.688	regulation of cell population proliferation
GO:0050731	0.671	positive regulation of peptidyl-tyrosine phosphorylation
GO:1902107	0.667	positive regulation of leukocyte differentiation
GO:0060759	0.661	regulation of response to cytokine stimulus
GO:0007165	0.658	signal transduction
GO:0044238	0.623	primary metabolic process
GO:0060760	0.620	positive regulation of response to cytokine stimulus
GO:0001959	0.618	regulation of cytokine-mediated signaling pathway
GO:2001021	0.578	negative regulation of response to DNA damage stimulus
GO:1902229	0.578	regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:0001961	0.559	positive regulation of cytokine-mediated signaling pathway
GO:0044237	0.558	cellular metabolic process
GO:0043516	0.557	regulation of DNA damage response, signal transduction by p53 class mediator
GO:0065009	0.532	regulation of molecular function
GO:0009889	0.451	regulation of biosynthetic process
GO:0032501	0.426	multicellular organismal process
GO:0008284	0.421	positive regulation of cell population proliferation
GO:0098542	0.417	defense response to other organism
GO:0051179	0.398	localization
GO:0032502	0.352	developmental process
GO:0032879	0.345	regulation of localization
GO:0048856	0.344	anatomical structure development
GO:0071310	0.342	cellular response to organic substance
GO:0031326	0.334	regulation of cellular biosynthetic process
GO:0009892	0.330	negative regulation of metabolic process
GO:0051234	0.305	establishment of localization
GO:0006810	0.302	transport
GO:0050790	0.300	regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0012505	0.998	endomembrane system
GO:0005886	0.998	plasma membrane
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0032991	0.972	protein-containing complex
GO:0005576	0.940	extracellular region
GO:0031410	0.910	cytoplasmic vesicle
GO:0005764	0.896	lysosome
GO:0005794	0.839	Golgi apparatus
GO:0009986	0.828	cell surface
GO:0005615	0.780	extracellular space
GO:0005783	0.759	endoplasmic reticulum
GO:0070013	0.738	intracellular organelle lumen
GO:0098796	0.735	membrane protein complex
GO:0098552	0.722	side of membrane
GO:0031090	0.677	organelle membrane
GO:0005768	0.671	endosome
GO:0043235	0.662	receptor complex
GO:0012506	0.536	vesicle membrane
GO:0030659	0.533	cytoplasmic vesicle membrane
GO:0070062	0.493	extracellular exosome
GO:0098588	0.492	bounding membrane of organelle
GO:0098797	0.442	plasma membrane protein complex
GO:0005634	0.373	nucleus
GO:0035692	0.372	macrophage migration inhibitory factor receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]