StarFunc result for job id P04264

User Input

>input (644 residues)
MSRQFSSRSGYRSGGGFSSGSAGIINYQRRTTSSSTRRSGGGGGRFSSCGGGGGSFGAGG
GFGSRSLVNLGGSKSISISVARGGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFG
GFGSGGGGFGGGGFGGGGYGGGYGPVCPPGGIQEVTINQSLLQPLNVEIDPEIQKVKSRE
REQIKSLNNQFASFIDKVRFLEQQNQVLQTKWELLQQVDTSTRTHNLEPYFESFINNLRR
RVDQLKSDQSRLDSELKNMQDMVEDYRNKYEDEINKRTNAENEFVTIKKDVDGAYMTKVD
LQAKLDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNRSLDLDSIIAEVKAQYED
IAQKSKAEAESLYQSKYEELQITAGRHGDSVRNSKIEISELNRVIQRLRSEIDNVKKQIS
NLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIA
TYRTLLEGEESRMSGECAPNVSVSVSTSHTTISGGGSRGGGGGGYGSGGSSYGSGGGSYG
SGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSG
GRGSGGGSSGGSIGGRGSSSGGVKSSGGSSSVKFVSTTYSGVTR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04264	1.000	1.000	2.982E-72	644	1.000	1.000	P04264.pdb.gz	K2C1_HUMAN Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6
2	AFDB:P04104	0.290	0.293	1.232E-47	637	0.773	0.782	P04104.pdb.gz	K2C1_MOUSE Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4
3	AFDB:P35908	0.261	0.263	1.004E-37	639	0.643	0.648	P35908.pdb.gz	K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens OX=9606 GN=KRT2 PE=1 SV=2
4	AFDB:P13647	0.474	0.509	6.979E-37	590	0.595	0.649	P13647.pdb.gz	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
5	AFDB:P02538	0.480	0.539	1.092E-36	564	0.573	0.654	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
6	AFDB:Q922U2	0.332	0.363	1.176E-36	580	0.576	0.640	Q922U2.pdb.gz	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
7	AFDB:Q6IFZ6	0.276	0.307	3.879E-36	572	0.561	0.631	Q6IFZ6.pdb.gz	K2C1B_MOUSE Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1
8	AFDB:Q9Z331	0.451	0.508	4.180E-36	562	0.564	0.646	Q9Z331.pdb.gz	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
9	AFDB:Q6PVZ5	0.311	0.331	1.600E-35	599	0.595	0.639	Q6PVZ5.pdb.gz	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1
10	AFDB:Q0IIN1	0.291	0.321	2.323E-35	578	0.562	0.626	Q0IIN1.pdb.gz	Q0IIN1_HUMAN Keratin 77 OS=Homo sapiens OX=9606 GN=KRT77 PE=1 SV=1
11	PDB:5lj5O	0.087	0.169	2.843	283	0.037	0.085	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
12	PDB:5wlcST	0.093	0.098	4.448	599	0.031	0.033	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
13	PDB:7d5sRN	0.086	0.090	5.563	607	0.031	0.033	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
14	PDB:7mqaNA	0.053	0.097	6.958	295	0.033	0.071	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6qw64A	0.044	0.114	8.078	239	0.025	0.067	6qw64A.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	O95678	576	551	0.469	0.548	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
2	P02538	578	564	0.480	0.548	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
3	P04104	658	637	0.593	0.600	K2C1_MOUSE Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4
4	P04259	582	564	0.483	0.551	K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo sapiens OX=9606 GN=KRT6B PE=1 SV=5
5	P04264	1234	644	1.000	1.000	K2C1_HUMAN Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6
6	P07744	559	525	0.458	0.562	K2C4_MOUSE Keratin, type II cytoskeletal 4 OS=Mus musculus OX=10090 GN=Krt4 PE=1 SV=2
7	P12035	533	628	0.404	0.414	K2C3_HUMAN Keratin, type II cytoskeletal 3 OS=Homo sapiens OX=9606 GN=KRT3 PE=1 SV=3
8	P13647	546	590	0.533	0.581	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
9	P19013	567	520	0.467	0.579	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
10	P35908	530	639	0.418	0.421	K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens OX=9606 GN=KRT2 PE=1 SV=2
11	P48668	580	564	0.483	0.551	K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3
12	P50446	575	553	0.419	0.488	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
13	Q0IIN1	566	578	0.461	0.514	Q0IIN1_HUMAN Keratin 77 OS=Homo sapiens OX=9606 GN=KRT77 PE=1 SV=1
14	Q14CN4	546	511	0.408	0.515	K2C72_HUMAN Keratin, type II cytoskeletal 72 OS=Homo sapiens OX=9606 GN=KRT72 PE=1 SV=2
15	Q3SY84	568	523	0.477	0.587	K2C71_HUMAN Keratin, type II cytoskeletal 71 OS=Homo sapiens OX=9606 GN=KRT71 PE=1 SV=3
16	Q3UV17	551	594	0.540	0.586	K22O_MOUSE Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1
17	Q5XKE5	581	535	0.461	0.555	K2C79_HUMAN Keratin, type II cytoskeletal 79 OS=Homo sapiens OX=9606 GN=KRT79 PE=1 SV=2
18	Q6IFZ5	534	581	0.444	0.492	Q6IFZ5_RAT Keratin 76 OS=Rattus norvegicus OX=10116 GN=Krt76 PE=2 SV=1
19	Q6IFZ6	548	572	0.469	0.528	K2C1B_MOUSE Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1
20	Q6P6Q2	569	576	0.408	0.457	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	42	15.7	Afadin- and alpha -actinin-Binding
2	PF11839 Alanine_zipper	0.11	24.1	Alanine-zipper, major outer membrane lipoprotein
3	PF08614 ATG16	3e+02	13.0	Autophagy protein 16 (ATG16)
4	PF04108 ATG17_like	37	15.2	Autophagy protein ATG17-like domain
5	PF00170 bZIP_1	2.6e+02	13.1	bZIP transcription factor
6	PF10473 CENP-F_leu_zip	2.3	19.7	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
7	PF07889 DUF1664	2e+02	13.4	Protein of unknown function (DUF1664)
8	PF14362 DUF4407	1.6	19.6	Domain of unknown function (DUF4407)
9	PF16888 DUF5082	6e+02	12.1	Domain of unknown function (DUF5082)
10	PF05335 DUF745	5.8	18.1	Protein of unknown function (DUF745)
11	PF03961 FapA	1e+03	10.7	Flagellar Assembly Protein A beta solenoid domain
12	PF00038 Filament	2.2e-102	354.4	Intermediate filament protein
13	PF16208 Keratin_2_head	2.9e-40	149.5	Keratin type II head
14	PF16210 Keratin_2_tail	3.5e-27	106.7	Keratin type II cytoskeletal 1 tail
15	PF18595 Nuf2_DHR10-like	5.4	18.5	Nuf2, DHR10-like domain
16	PF05546 She9_MDM33	39	15.5	She9 / Mdm33 family
17	PF04102 SlyX	68	15.5	SlyX
18	PF07926 TPR_MLP1_2	0.00032	32.1	TPR/MLP1/MLP2-like protein
19	PF12718 Tropomyosin_1	25	16.5	Tropomyosin like
20	PF10779 XhlA	42	15.8	Haemolysin XhlA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252244

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225698	0.983	Complement component 1 Q subcomponent-binding protein, mitochondrial
2	9606.ENSP00000269576	0.979	Keratin, type I cytoskeletal 10
3	9606.ENSP00000310861	0.934	Keratin, type II cytoskeletal 2 epidermal
4	9606.ENSP00000265023	0.925	Kininogen-1
5	9606.ENSP00000342710	0.895	Keratin, type II cytoskeletal 1b
6	9606.ENSP00000357731	0.894	Loricrin
7	9606.ENSP00000206765	0.873	Protein-glutamine gamma-glutamyltransferase K
8	9606.ENSP00000357789	0.864	Filaggrin
9	9606.ENSP00000357753	0.852	Involucrin
10	9606.ENSP00000252242	0.849	Keratin, type II cytoskeletal 5
11	9606.ENSP00000308720	0.839	Trypsin-1
12	9606.ENSP00000369129	0.796	Desmoplakin
13	9606.ENSP00000345206	0.778	Recombining binding protein suppressor of hairless
14	9606.ENSP00000374323	0.739	Ephrin type-A receptor 6
15	9606.ENSP00000360597	0.725	Leucine-rich repeat-containing protein 26
16	9606.ENSP00000253496	0.714	Coagulation factor XII
17	9606.ENSP00000256104	0.675	Fatty acid-binding protein, adipocyte
18	9606.ENSP00000002165	0.646	Plasma alpha-L-fucosidase
19	9606.ENSP00000301365	0.640	Transient receptor potential cation channel subfamily V member 3
20	9606.ENSP00000257192	0.637	Desmoglein-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.999	structural molecule activity
GO:0030246	0.857	carbohydrate binding
GO:0046982	0.857	protein heterodimerization activity
GO:0030280	0.499	structural constituent of skin epidermis
GO:0005200	0.370	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0048856	0.980	anatomical structure development
GO:0050789	0.961	regulation of biological process
GO:0008544	0.926	epidermis development
GO:0071840	0.798	cellular component organization or biogenesis
GO:0016043	0.791	cellular component organization
GO:0071704	0.784	organic substance metabolic process
GO:0044238	0.778	primary metabolic process
GO:0006807	0.702	nitrogen compound metabolic process
GO:0043170	0.644	macromolecule metabolic process
GO:1901564	0.618	organonitrogen compound metabolic process
GO:0019538	0.597	protein metabolic process
GO:0050794	0.555	regulation of cellular process
GO:0050896	0.544	response to stimulus
GO:0036211	0.518	protein modification process
GO:0048513	0.516	animal organ development
GO:0048518	0.474	positive regulation of biological process
GO:0018149	0.473	peptide cross-linking
GO:0060429	0.437	epithelium development
GO:0032501	0.361	multicellular organismal process
GO:0043588	0.361	skin development
GO:0048519	0.342	negative regulation of biological process
GO:0030154	0.322	cell differentiation
GO:0030855	0.301	epithelial cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005615	0.999	extracellular space
GO:0031982	0.999	vesicle
GO:0005886	0.995	plasma membrane
GO:0005856	0.995	cytoskeleton
GO:0043230	0.991	extracellular organelle
GO:0001533	0.989	cornified envelope
GO:0045095	0.979	keratin filament
GO:0005829	0.972	cytosol
GO:1903561	0.971	extracellular vesicle
GO:0005634	0.965	nucleus
GO:0070062	0.930	extracellular exosome
GO:0070013	0.459	intracellular organelle lumen
GO:0031981	0.373	nuclear lumen
GO:0062023	0.371	collagen-containing extracellular matrix
GO:0012505	0.323	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]