StarFunc result for job id P04279

User Input

>input (462 residues)
MKPNIIFVLSLLLILEKQAAVMGQKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESK
GSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSK
GHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSG
AQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCP
AHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHY
GENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQSSSTEERRLHY
GENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSH
EQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04279	0.999	0.999	5.306E-66	462	1.000	1.000	P04279.pdb.gz	SEMG1_HUMAN Semenogelin-1 OS=Homo sapiens OX=9606 GN=SEMG1 PE=1 SV=2
2	AFDB:Q02383	0.085	0.071	6.960E-41	582	0.786	0.624	Q02383.pdb.gz	SEMG2_HUMAN Semenogelin-2 OS=Homo sapiens OX=9606 GN=SEMG2 PE=1 SV=1
3	AFDB:Q6R8J2	0.069	0.038	4.524E-1	977	0.175	0.083	Q6R8J2.pdb.gz	HEG_DANRE Protein HEG OS=Danio rerio OX=7955 GN=heg PE=1 SV=1
4	AFDB:Q96GP6	0.077	0.050	7.524E-1	871	0.134	0.071	Q96GP6.pdb.gz	SREC2_HUMAN Scavenger receptor class F member 2 OS=Homo sapiens OX=9606 GN=SCARF2 PE=1 SV=5
5	AFDB:Q3TXU6	0.065	0.045	8.190E-1	800	0.147	0.085	Q3TXU6.pdb.gz	Q3TXU6_MOUSE Matrin-type domain-containing protein OS=Mus musculus OX=10090 GN=Ciz1 PE=2 SV=1
6	AFDB:F4JLV7	0.054	0.048	8.915E-1	530	0.082	0.072	F4JLV7.pdb.gz	F4JLV7_ARATH Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g22505 PE=1 SV=1
7	AFDB:Q8VEH2	0.082	0.051	1.150	845	0.147	0.080	Q8VEH2.pdb.gz	Q8VEH2_MOUSE CDKN1A interacting zinc finger protein 1 OS=Mus musculus OX=10090 GN=Ciz1 PE=1 SV=1
8	AFDB:A1L1S4	0.068	0.054	1.362	618	0.117	0.087	A1L1S4.pdb.gz	A1L1S4_DANRE Shugoshin-like 1 OS=Danio rerio OX=7955 GN=sgol1 PE=2 SV=1
9	AFDB:Q62728	0.058	0.033	1.362	1175	0.193	0.076	Q62728.pdb.gz	PTN21_RAT Tyrosine-protein phosphatase non-receptor type 21 OS=Rattus norvegicus OX=10116 GN=Ptpn21 PE=1 SV=1
10	AFDB:A0A0S3NTN0	0.061	0.041	1.483	784	0.121	0.071	A0A0S3NTN0.pdb.gz
11	PDB:3j79V	0.045	0.111	1.829	155	0.022	0.065	3j79V.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
12	PDB:1rquA	0.054	0.154	3.605	120	0.013	0.050	1rquA.pdb.gz
13	PDB:3e9dA	0.044	0.077	5.509	250	0.017	0.032	3e9dA.pdb.gz
14	PDB:5xtcb	0.056	0.184	7.105	124	0.013	0.048	5xtcb.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
15	PDB:7z0sC	0.057	0.045	7.105	604	0.019	0.015	7z0sC.pdb.gz	Structure of the membrane-bound formate hydrogenlyase complex from Escherichia coli.
16	PDB:6rw4O	0.036	0.069	8.418	194	0.011	0.026	6rw4O.pdb.gz	Distinct pre-initiation steps in human mitochondrial translation.
17	PDB:6tedR	0.059	0.098	9.163	244	0.013	0.025	6tedR.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
18	PDB:5iy6U	0.044	0.103	9.974	170	0.011	0.029	5iy6U.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P04279	0.0	934	462	1.000	1.000	SEMG1_HUMAN Semenogelin-1 OS=Homo sapiens OX=9606 GN=SEMG1 PE=1 SV=2
2	Q02383	0.0	593	582	0.682	0.541	SEMG2_HUMAN Semenogelin-2 OS=Homo sapiens OX=9606 GN=SEMG2 PE=1 SV=1
3	Q8C1W4	1.33e-06	52.8	375	0.082	0.101	Q8C1W4_MOUSE Seminal vesicle secretory protein 2 OS=Mus musculus OX=10090 GN=Semg1 PE=2 SV=1
4	Q3B802	1.62e-06	52.4	409	0.078	0.088	Q3B802_MOUSE Svs2 protein (Fragment) OS=Mus musculus OX=10090 GN=Semg1 PE=2 SV=1
5	Q8BS30	1.90e-06	52.4	375	0.082	0.101	Q8BS30_MOUSE Semenogelin 1 OS=Mus musculus OX=10090 GN=Semg1 PE=1 SV=1
6	Q3UN62	2.00e-06	52.0	375	0.082	0.101	Q3UN62_MOUSE Seminal vesicle secretory protein 2 OS=Mus musculus OX=10090 GN=Semg1 PE=2 SV=1
7	Q8CBV5	3.37e-05	48.1	375	0.080	0.099	Q8CBV5_MOUSE Seminal vesicle secretory protein 2 OS=Mus musculus OX=10090 GN=Semg1 PE=2 SV=1
8	Q6N022	5.1	32.3	2769	0.041	0.007	TEN4_HUMAN Teneurin-4 OS=Homo sapiens OX=9606 GN=TENM4 PE=1 SV=2
9	P33338	8.6	31.6	968	0.054	0.026	SLA2_YEAST Protein SLA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLA2 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05474 Semenogelin	1.6e-248	837.7	Semenogelin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361867

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231751	0.889	Lactotransferrin
2	9606.ENSP00000361746	0.879	Eppin
3	9606.ENSP00000424176	0.854	EPPIN-WFDC6 readthrough
4	9606.ENSP00000361871	0.827	WAP four-disulfide core domain protein 12
5	9606.ENSP00000315130	0.811	Clusterin
6	9606.ENSP00000314151	0.770	Prostate-specific antigen
7	9606.ENSP00000361735	0.701	WAP four-disulfide core domain containing
8	9606.ENSP00000279058	0.686	Serine peptidase inhibitor, Kunitz type 4
9	9606.ENSP00000313581	0.681	Kallikrein-2
10	9606.ENSP00000351327	0.670	A-kinase anchor protein 4
11	9606.ENSP00000243924	0.654	Elafin
12	9606.ENSP00000361755	0.609	WAP four-disulfide core domain containing
13	9606.ENSP00000342082	0.607	Antileukoproteinase
14	9606.ENSP00000458537	0.576	Chymotrypsin-like protease CTRL-1
15	9606.ENSP00000362924	0.572	Gelsolin
16	9606.ENSP00000381448	0.572	Cystatin-C
17	9606.ENSP00000236850	0.565	Apolipoprotein A-I
18	9606.ENSP00000308595	0.564	Olfactory receptor 5R1
19	9606.ENSP00000452780	0.562	Beta-2-microglobulin
20	9606.ENSP00000237014	0.560	Transthyretin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008270	1.000	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0009987	0.985	cellular process
GO:0002376	0.985	immune system process
GO:0050790	0.985	regulation of catalytic activity
GO:0032501	0.984	multicellular organismal process
GO:0044093	0.982	positive regulation of molecular function
GO:0006955	0.982	immune response
GO:0030162	0.981	regulation of proteolysis
GO:0051336	0.979	regulation of hydrolase activity
GO:0098542	0.978	defense response to other organism
GO:0010604	0.977	positive regulation of macromolecule metabolic process
GO:0043085	0.971	positive regulation of catalytic activity
GO:0051173	0.966	positive regulation of nitrogen compound metabolic process
GO:0051049	0.961	regulation of transport
GO:0042742	0.939	defense response to bacterium
GO:0051247	0.939	positive regulation of protein metabolic process
GO:0052547	0.935	regulation of peptidase activity
GO:0019730	0.935	antimicrobial humoral response
GO:0050817	0.933	coagulation
GO:0019731	0.933	antibacterial humoral response
GO:0048519	0.927	negative regulation of biological process
GO:0003352	0.927	regulation of cilium movement
GO:0048523	0.916	negative regulation of cellular process
GO:0045862	0.909	positive regulation of proteolysis
GO:0051345	0.906	positive regulation of hydrolase activity
GO:0060295	0.837	regulation of cilium movement involved in cell motility
GO:0052548	0.835	regulation of endopeptidase activity
GO:0010952	0.793	positive regulation of peptidase activity
GO:0010950	0.760	positive regulation of endopeptidase activity
GO:0022414	0.735	reproductive process
GO:0010959	0.697	regulation of metal ion transport
GO:0007620	0.635	copulation
GO:0051924	0.622	regulation of calcium ion transport
GO:0090279	0.604	regulation of calcium ion import
GO:0044703	0.566	multi-organism reproductive process
GO:0001906	0.474	cell killing
GO:0044706	0.465	multi-multicellular organism process
GO:0061844	0.326	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:1901318	0.319	negative regulation of flagellated sperm motility
GO:0051926	0.307	negative regulation of calcium ion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070062	1.000	extracellular exosome
GO:0032991	0.998	protein-containing complex
GO:0005737	0.699	cytoplasm
GO:0012505	0.452	endomembrane system
GO:0070013	0.346	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]