StarFunc result for job id P04406

User Input

>input (335 residues)
MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTV
KAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI
ISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHA
ITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV
SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAG
IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04406	1.000	1.000	1.239E-78	335	1.000	1.000	P04406.pdb.gz	G3P_HUMAN Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3
2	PDB:6m61O	0.997	0.994	4.469E-74	336	1.000	0.997	6m61O.pdb.gz	Biosynthesis of the fungal glyceraldehyde-3-phosphate dehydrogenase inhibitor heptelidic acid and mechanism of self-resistance
3	AFDB:P07486	0.987	0.996	4.955E-68	332	0.758	0.765	P07486.pdb.gz	G3P1_DROME Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Drosophila melanogaster OX=7227 GN=Gapdh1 PE=2 SV=2
4	AFDB:P78958	0.995	0.992	8.615E-66	336	0.713	0.711	P78958.pdb.gz	G3P1_SCHPO Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tdh1 PE=1 SV=1
5	AFDB:Q5ADM7	0.985	0.985	4.513E-64	335	0.666	0.666	Q5ADM7.pdb.gz	Q5ADM7_CANAL Glyceraldehyde-3-phosphate dehydrogenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TDH3 PE=1 SV=1
6	AFDB:P20445	0.986	0.983	5.088E-64	336	0.681	0.679	P20445.pdb.gz	G3P_EMENI Glyceraldehyde-3-phosphate dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpdA PE=1 SV=2
7	AFDB:Q12552	0.985	0.982	5.737E-64	336	0.696	0.693	Q12552.pdb.gz	G3P_ASPNG Glyceraldehyde-3-phosphate dehydrogenase OS=Aspergillus niger OX=5061 GN=gpdA PE=3 SV=2
8	AFDB:P08735	0.992	0.986	1.045E-63	337	0.699	0.694	P08735.pdb.gz	G3PC1_MAIZE Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic OS=Zea mays OX=4577 GN=GAPC1 PE=2 SV=2
9	AFDB:Q9SAJ6	0.988	0.785	1.045E-63	422	0.696	0.552	Q9SAJ6.pdb.gz	G3PP1_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GAPCP1 PE=1 SV=1
10	AFDB:O14556	0.983	0.807	1.411E-63	408	0.681	0.559	O14556.pdb.gz	G3PT_HUMAN Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Homo sapiens OX=9606 GN=GAPDHS PE=1 SV=2
11	AFDB:Q5E924	0.988	0.789	1.411E-63	420	0.693	0.552	Q5E924.pdb.gz	G3PP2_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GAPCP2 PE=2 SV=1
12	PDB:3pymA	0.976	0.985	1.729E-59	332	0.639	0.645	3pymA.pdb.gz	?
13	PDB:3cifA	0.982	0.973	4.972E-58	338	0.648	0.642	3cifA.pdb.gz	An unexpected phosphate binding site in Glyceraldehyde 3-Phosphate Dehydrogenase: Crystal structures of apo, holo and ternary complex of Cryptosporidium parvum enzyme
14	PDB:6qunO	0.977	0.980	1.347E-56	334	0.669	0.671	6qunO.pdb.gz	Glutathionylation primes soluble glyceraldehyde-3-phosphate dehydrogenase for late collapse into insoluble aggregates.
15	PDB:1dc4A	0.968	0.982	4.469E-56	330	0.651	0.661	1dc4A.pdb.gz	Structural analysis of glyceraldehyde 3-phosphate dehydrogenase from Escherichia coli: direct evidence of substrate binding and cofactor-induced conformational changes.
16	PDB:3cmcO	0.967	0.970	3.925E-53	334	0.534	0.536	3cmcO.pdb.gz	Trapping of the Thioacylglyceraldehyde-3-phosphate Dehydrogenase Intermediate from Bacillus stearothermophilus: DIRECT EVIDENCE FOR A FLIP-FLOP MECHANISM
17	PDB:3gpdR	0.970	0.973	1.758E-52	334	0.896	0.898	3gpdR.pdb.gz	Twinning in crystals of human skeletal muscle D-glyceraldehyde-3-phosphate dehydrogenase.
18	PDB:3hjaA	0.944	0.947	7.079E-50	334	0.493	0.494	3hjaA.pdb.gz	Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Borrelia burgdorferi
19	PDB:7zq3R	0.974	0.938	7.981E-50	348	0.445	0.428	7zq3R.pdb.gz	Structural snapshots of nitrosoglutathione binding and reactivity underlying S-nitrosylation of photosynthetic GAPDH.
20	PDB:1hdgO	0.953	0.961	9.911E-49	332	0.475	0.479	1hdgO.pdb.gz	The crystal structure of holo-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic bacterium Thermotoga maritima at 2.5 A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EUT5	0.0	530	260	0.764	0.985	E7EUT5_HUMAN Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=1
2	P00356	0.0	634	333	0.913	0.919	G3P_CHICK Glyceraldehyde-3-phosphate dehydrogenase OS=Gallus gallus OX=9031 GN=GAPDH PE=2 SV=3
3	P04406	0.0	691	335	1.000	1.000	G3P_HUMAN Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3
4	P04797	0.0	649	333	0.934	0.940	G3P_RAT Glyceraldehyde-3-phosphate dehydrogenase OS=Rattus norvegicus OX=10116 GN=Gapdh PE=1 SV=3
5	P07486	0.0	529	332	0.755	0.762	G3P1_DROME Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Drosophila melanogaster OX=7227 GN=Gapdh1 PE=2 SV=2
6	P07487	0.0	529	332	0.752	0.759	G3P2_DROME Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Drosophila melanogaster OX=7227 GN=Gapdh2 PE=1 SV=2
7	P10096	0.0	651	333	0.940	0.946	G3P_BOVIN Glyceraldehyde-3-phosphate dehydrogenase OS=Bos taurus OX=9913 GN=GAPDH PE=1 SV=4
8	P16858	0.0	648	333	0.934	0.940	G3P_MOUSE Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus OX=10090 GN=Gapdh PE=1 SV=2
9	P46406	0.0	652	333	0.943	0.949	G3P_RABIT Glyceraldehyde-3-phosphate dehydrogenase OS=Oryctolagus cuniculus OX=9986 GN=GAPDH PE=1 SV=3
10	V9HVZ4	0.0	691	335	1.000	1.000	V9HVZ4_HUMAN Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=HEL-S-162eP PE=2 SV=1
11	O43026	1.40e-180	504	335	0.722	0.722	G3P2_SCHPO Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpd3 PE=1 SV=1
12	P78958	1.07e-178	499	336	0.713	0.711	G3P1_SCHPO Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tdh1 PE=1 SV=1
13	Q09054	2.33e-177	496	337	0.696	0.691	G3PC2_MAIZE Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic OS=Zea mays OX=4577 GN=GAPC2 PE=2 SV=1
14	Q94469	4.77e-177	495	335	0.696	0.696	G3P_DICDI Glyceraldehyde-3-phosphate dehydrogenase OS=Dictyostelium discoideum OX=44689 GN=gpdA PE=1 SV=2
15	P08735	7.44e-177	495	337	0.701	0.697	G3PC1_MAIZE Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic OS=Zea mays OX=4577 GN=GAPC1 PE=2 SV=2
16	Q12552	1.04e-176	494	336	0.696	0.693	G3P_ASPNG Glyceraldehyde-3-phosphate dehydrogenase OS=Aspergillus niger OX=5061 GN=gpdA PE=3 SV=2
17	Q9SAJ6	1.84e-176	497	422	0.696	0.552	G3PP1_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GAPCP1 PE=1 SV=1
18	Q5E924	1.12e-174	493	420	0.693	0.552	G3PP2_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GAPCP2 PE=2 SV=1
19	P20445	7.46e-172	482	336	0.678	0.676	G3P_EMENI Glyceraldehyde-3-phosphate dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpdA PE=1 SV=2
20	Q9ESV6	4.92e-171	484	432	0.684	0.530	G3PT_RAT Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Rattus norvegicus OX=10116 GN=Gapdhs PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01113 DapB_N	1.2e+02	14.2	Dihydrodipicolinate reductase, N-terminus
2	PF02800 Gp_dh_C	3.7e-66	233.1	Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
3	PF00044 Gp_dh_N	5.8e-36	134.2	Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
4	PF03968 LptD_N	3.1e+02	13.0	LptA/(LptD N-terminal domain) LPS transport protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000229239

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229270	0.999	Triosephosphate isomerase 1
2	9606.ENSP00000358635	0.999	Heterogeneous nuclear ribonucleoprotein Q
3	9606.ENSP00000362413	0.999	Phosphoglycerate kinase 1
4	9606.ENSP00000375730	0.999	60S ribosomal protein L13a
5	9606.ENSP00000349156	0.997	E3 ubiquitin-protein ligase SIAH1
6	9606.ENSP00000378669	0.997	Fructose-bisphosphate aldolase A
7	9606.ENSP00000355890	0.996	Bifunctional glutamate/proline--tRNA ligase
8	9606.ENSP00000234590	0.995	Alpha-enolase
9	9606.ENSP00000347184	0.995	Huntingtin
10	9606.ENSP00000308938	0.990	Plasminogen
11	9606.ENSP00000342007	0.989	Cytochrome P450 1A2
12	9606.ENSP00000305995	0.988	Phosphoglycerate kinase 2
13	9606.ENSP00000346839	0.988	Fibronectin type III domain containing
14	9606.ENSP00000405573	0.988	Glucose-6-phosphate isomerase
15	9606.ENSP00000262187	0.987	GTP-binding protein Rheb
16	9606.ENSP00000262646	0.980	Ras-related protein Rab-2A
17	9606.ENSP00000284981	0.980	Amyloid-beta A4 protein
18	9606.ENSP00000377192	0.975	Glucose-6-phosphate 1-dehydrogenase
19	9606.ENSP00000349960	0.972	Actin, cytoplasmic 1
20	9606.ENSP00000226253	0.970	Belongs to the class I fructose-bisphosphate aldolase family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0004365	0.998	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0097159	0.961	organic cyclic compound binding
GO:1901363	0.960	heterocyclic compound binding
GO:0036094	0.825	small molecule binding
GO:0017076	0.386	purine nucleotide binding
GO:0042802	0.376	identical protein binding
GO:0030554	0.332	adenyl nucleotide binding
GO:0043167	0.330	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0071704	0.983	organic substance metabolic process
GO:0050794	0.981	regulation of cellular process
GO:0044238	0.972	primary metabolic process
GO:0044237	0.956	cellular metabolic process
GO:0006807	0.892	nitrogen compound metabolic process
GO:0005975	0.869	carbohydrate metabolic process
GO:0016310	0.852	phosphorylation
GO:0019222	0.830	regulation of metabolic process
GO:0048523	0.823	negative regulation of cellular process
GO:0050896	0.794	response to stimulus
GO:0048518	0.790	positive regulation of biological process
GO:0060255	0.710	regulation of macromolecule metabolic process
GO:0044281	0.694	small molecule metabolic process
GO:0048522	0.694	positive regulation of cellular process
GO:0034641	0.668	cellular nitrogen compound metabolic process
GO:1901564	0.663	organonitrogen compound metabolic process
GO:0009056	0.649	catabolic process
GO:1901575	0.635	organic substance catabolic process
GO:1901360	0.615	organic cyclic compound metabolic process
GO:0046483	0.605	heterocycle metabolic process
GO:0006725	0.596	cellular aromatic compound metabolic process
GO:0046939	0.570	nucleotide phosphorylation
GO:0032879	0.558	regulation of localization
GO:0006139	0.551	nucleobase-containing compound metabolic process
GO:0051171	0.524	regulation of nitrogen compound metabolic process
GO:0080090	0.509	regulation of primary metabolic process
GO:0031323	0.491	regulation of cellular metabolic process
GO:0010468	0.468	regulation of gene expression
GO:0051049	0.458	regulation of transport
GO:0009889	0.439	regulation of biosynthetic process
GO:0006753	0.422	nucleoside phosphate metabolic process
GO:0051716	0.418	cellular response to stimulus
GO:0048583	0.414	regulation of response to stimulus
GO:0031326	0.408	regulation of cellular biosynthetic process
GO:0009893	0.395	positive regulation of metabolic process
GO:0010556	0.376	regulation of macromolecule biosynthetic process
GO:0010604	0.365	positive regulation of macromolecule metabolic process
GO:0009132	0.362	nucleoside diphosphate metabolic process
GO:0071840	0.329	cellular component organization or biogenesis
GO:0051173	0.328	positive regulation of nitrogen compound metabolic process
GO:0006091	0.318	generation of precursor metabolites and energy
GO:0042221	0.310	response to chemical
GO:0006950	0.307	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.990	cytosol
GO:0016020	0.982	membrane
GO:0043231	0.961	intracellular membrane-bounded organelle
GO:0012505	0.926	endomembrane system
GO:0070013	0.918	intracellular organelle lumen
GO:0005634	0.704	nucleus
GO:0071944	0.681	cell periphery
GO:0005886	0.415	plasma membrane
GO:0005654	0.316	nucleoplasm
GO:0032991	0.309	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10300	0.998	D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH
EC:1.2.1.12	0.998	glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).

[back to server]