StarFunc result for job id P04424

User Input

>input (464 residues)
MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEM
DQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTD
LRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVAL
TRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVA
EFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKA
GRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENM
GQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLF
SGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04424	1.000	1.000	4.980E-69	464	1.000	1.000	P04424.pdb.gz	ARLY_HUMAN Argininosuccinate lyase OS=Homo sapiens OX=9606 GN=ASL PE=1 SV=4
2	PDB:1k62B	0.965	0.975	6.312E-64	459	0.981	0.991	1k62B.pdb.gz
3	AFDB:P20673	0.990	0.996	2.116E-63	461	0.890	0.896	P20673.pdb.gz	ARLY_RAT Argininosuccinate lyase OS=Rattus norvegicus OX=10116 GN=Asl PE=2 SV=1
4	AFDB:P24058	0.988	0.980	1.593E-56	468	0.713	0.707	P24058.pdb.gz	ARLY2_ANAPL Argininosuccinate lyase OS=Anas platyrhynchos OX=8839 GN=ASL2 PE=1 SV=4
5	AFDB:P02521	0.992	0.987	1.652E-53	466	0.651	0.648	P02521.pdb.gz	ARLY1_CHICK Delta-1 crystallin OS=Gallus gallus OX=9031 GN=ASL1 PE=1 SV=2
6	PDB:1k7wD	0.961	0.991	4.499E-53	450	0.688	0.709	1k7wD.pdb.gz	Mutational analysis of duck delta 2 crystallin and the structure of an inactive mutant with bound substrate provide insight into the enzymatic mechanism of argininosuccinate lyase.
7	PDB:1i0aA	0.957	0.980	4.678E-51	453	0.640	0.656	1i0aA.pdb.gz
8	AFDB:P40369	0.973	0.979	2.544E-49	461	0.547	0.551	P40369.pdb.gz	ARLY_SCHPO Argininosuccinate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arg7 PE=1 SV=2
9	AFDB:Q59R31	0.970	0.961	4.520E-49	468	0.526	0.521	Q59R31.pdb.gz	Q59R31_CANAL Arginosuccinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARG4 PE=3 SV=1
10	AFDB:P50514	0.974	0.983	5.894E-49	460	0.554	0.559	P50514.pdb.gz	ARLZ_SCHPO Probable argininosuccinate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=argx PE=3 SV=1
11	AFDB:P04076	0.978	0.980	1.560E-48	463	0.541	0.542	P04076.pdb.gz	ARLY_YEAST Argininosuccinate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARG4 PE=1 SV=2
12	AFDB:C8VJ67	0.975	0.977	3.028E-48	463	0.517	0.518	C8VJ67.pdb.gz	C8VJ67_EMENI Arginosuccinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02914 PE=3 SV=1
13	PDB:1dcnB	0.889	0.986	1.593E-45	418	0.638	0.708	1dcnB.pdb.gz	Crystal structure of an inactive duck delta II crystallin mutant with bound argininosuccinate.
14	AFDB:Q9LEU8	0.964	0.867	2.181E-41	517	0.412	0.369	Q9LEU8.pdb.gz	ARLY_ARATH Argininosuccinate lyase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g10920 PE=2 SV=1
15	PDB:6iemB	0.956	0.960	1.568E-39	462	0.416	0.418	6iemB.pdb.gz
16	PDB:1tj7A	0.939	0.957	1.871E-39	455	0.442	0.451	1tj7A.pdb.gz	Structure determination and refinement at 2.44 A resolution of argininosuccinate lyase from Escherichia coli.
17	PDB:4flcB	0.697	0.697	2.097E-15	464	0.172	0.172	4flcB.pdb.gz
18	PDB:4apbD	0.709	0.712	4.858E-15	462	0.183	0.184	4apbD.pdb.gz	Conformational Changes Upon Ligand Binding in the Essential Class II Fumarase Rv1098C from Mycobacterium Tuberculosis.
19	PDB:6nzbA	0.686	0.689	6.335E-15	462	0.170	0.171	6nzbA.pdb.gz
20	PDB:7lubB	0.724	0.727	7.903E-15	462	0.162	0.162	7lubB.pdb.gz	Protein-metabolite interactomics of carbohydrate metabolism reveal regulation of lactate dehydrogenase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02521	0.0	649	466	0.651	0.648	ARLY1_CHICK Delta-1 crystallin OS=Gallus gallus OX=9031 GN=ASL1 PE=1 SV=2
2	P04424	0.0	958	464	1.000	1.000	ARLY_HUMAN Argininosuccinate lyase OS=Homo sapiens OX=9606 GN=ASL PE=1 SV=4
3	P05083	0.0	686	466	0.694	0.691	ARLY2_CHICK Argininosuccinate lyase OS=Gallus gallus OX=9031 GN=ASL2 PE=2 SV=1
4	P20673	0.0	844	461	0.890	0.896	ARLY_RAT Argininosuccinate lyase OS=Rattus norvegicus OX=10116 GN=Asl PE=2 SV=1
5	P24057	0.0	686	466	0.692	0.689	ARLY1_ANAPL Delta-1 crystallin OS=Anas platyrhynchos OX=8839 GN=ASL1 PE=1 SV=1
6	P24058	0.0	703	468	0.713	0.707	ARLY2_ANAPL Argininosuccinate lyase OS=Anas platyrhynchos OX=8839 GN=ASL2 PE=1 SV=4
7	P33110	0.0	686	466	0.688	0.685	ARLY_ANSAN Argininosuccinate lyase OS=Anser anser anser OX=8844 GN=ASL PE=1 SV=1
8	P40369	0.0	538	461	0.543	0.547	ARLY_SCHPO Argininosuccinate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arg7 PE=1 SV=2
9	P50514	0.0	560	460	0.554	0.559	ARLZ_SCHPO Probable argininosuccinate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=argx PE=3 SV=1
10	Q59R31	0.0	523	468	0.526	0.521	Q59R31_CANAL Arginosuccinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARG4 PE=3 SV=1
11	Q7SIE0	0.0	649	466	0.653	0.650	ARLY1_MELGA Delta-1 crystallin OS=Meleagris gallopavo OX=9103 GN=ASL1 PE=1 SV=1
12	Q91YI0	0.0	891	464	0.940	0.940	ARLY_MOUSE Argininosuccinate lyase OS=Mus musculus OX=10090 GN=Asl PE=1 SV=1
13	P04076	1.05e-180	515	463	0.541	0.542	ARLY_YEAST Argininosuccinate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARG4 PE=1 SV=2
14	C8VJ67	2.23e-174	499	463	0.517	0.518	C8VJ67_EMENI Arginosuccinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02914 PE=3 SV=1
15	P11447	1.18e-123	369	457	0.446	0.453	ARLY_ECOLI Argininosuccinate lyase OS=Escherichia coli (strain K12) OX=83333 GN=argH PE=1 SV=3
16	Q9LEU8	2.23e-122	368	517	0.412	0.369	ARLY_ARATH Argininosuccinate lyase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g10920 PE=2 SV=1
17	Q72D36	5.06e-118	355	460	0.418	0.422	ARLY_DESVH Argininosuccinate lyase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=argH PE=1 SV=1
18	P9WPY7	3.41e-105	322	470	0.427	0.421	ARLY_MYCTU Argininosuccinate lyase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=argH PE=1 SV=1
19	Q5KTJ0	1.41e-15	72.8	49	0.069	0.653	Q5KTJ0_CHICK Delta-2-crystallin (Fragment) OS=Gallus gallus OX=9031 GN=CRYD2 PE=4 SV=1
20	P39461	1.13e-06	53.1	438	0.147	0.155	FUMC_SACS2 Fumarate hydratase class II OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=fumC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14698 ASL_C2	8.5e-18	76.2	Argininosuccinate lyase C-terminal
2	PF00206 Lyase_1	1.3e-101	351.7	Lyase
3	PF16943 T4SS_CagC	73	15.0	Cag pathogenicity island, type IV secretory system

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307188

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361471	0.999	Argininosuccinate synthase
2	9606.ENSP00000039007	0.979	Ornithine carbamoyltransferase, mitochondrial
3	9606.ENSP00000349446	0.978	Arginase-1
4	9606.ENSP00000293404	0.970	N-acetylglutamate synthase, mitochondrial
5	9606.ENSP00000297494	0.968	Nitric oxide synthase, endothelial
6	9606.ENSP00000485525	0.967	Adenylosuccinate lyase
7	9606.ENSP00000261783	0.962	Arginase-2, mitochondrial
8	9606.ENSP00000477999	0.948	Nitric oxide synthase, brain
9	9606.ENSP00000294517	0.936	Antizyme inhibitor 2
10	9606.ENSP00000327251	0.936	Nitric oxide synthase, inducible
11	9606.ENSP00000355518	0.922	Fumarate hydratase, mitochondrial
12	9606.ENSP00000379895	0.880	Glycine amidinotransferase, mitochondrial
13	9606.ENSP00000360268	0.874	Delta-1-pyrroline-5-carboxylate synthase
14	9606.ENSP00000377532	0.871	Pyruvate carboxylase, mitochondrial
15	9606.ENSP00000327070	0.865	Malate dehydrogenase, mitochondrial
16	9606.ENSP00000342056	0.865	Citrate synthase, mitochondrial
17	9606.ENSP00000299518	0.863	Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
18	9606.ENSP00000357838	0.851	Ornithine aminotransferase, mitochondrial
19	9606.ENSP00000319814	0.848	Phosphoenolpyruvate carboxykinase, cytosolic [GTP]
20	9606.ENSP00000402608	0.847	Carbamoyl-phosphate synthase [ammonia], mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004056	0.999	argininosuccinate lyase activity
GO:0005515	0.998	protein binding
GO:0005212	0.757	structural constituent of eye lens
GO:0042802	0.543	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006520	0.995	amino acid metabolic process
GO:1901605	0.994	alpha-amino acid metabolic process
GO:0044283	0.963	small molecule biosynthetic process
GO:0009064	0.903	glutamine family amino acid metabolic process
GO:1901576	0.899	organic substance biosynthetic process
GO:0044249	0.891	cellular biosynthetic process
GO:1901566	0.861	organonitrogen compound biosynthetic process
GO:0065007	0.815	biological regulation
GO:0050789	0.811	regulation of biological process
GO:0006525	0.809	arginine metabolic process
GO:0019222	0.733	regulation of metabolic process
GO:0048518	0.649	positive regulation of biological process
GO:0009893	0.633	positive regulation of metabolic process
GO:0051171	0.614	regulation of nitrogen compound metabolic process
GO:1904407	0.576	positive regulation of nitric oxide metabolic process
GO:0050794	0.533	regulation of cellular process
GO:1901607	0.516	alpha-amino acid biosynthetic process
GO:0009084	0.430	glutamine family amino acid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.986	cytosol
GO:0043227	0.970	membrane-bounded organelle
GO:0005576	0.918	extracellular region
GO:0070062	0.846	extracellular exosome
GO:0043231	0.807	intracellular membrane-bounded organelle
GO:0070013	0.792	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24020	0.999	2-(N(omega)-L-arginino)succinate = fumarate + L-arginine
EC:4.3.2.1	0.999	argininosuccinate lyase.

[back to server]