StarFunc result for job id P04439

User Input

>input (365 residues)
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQ
IMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQL
RAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEL
SSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSL
TACKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04439	1.000	1.000	5.567E-67	365	1.000	1.000	P04439.pdb.gz	HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2
2	AFDB:P01889	0.878	0.885	1.243E-57	362	0.849	0.856	P01889.pdb.gz	HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
3	AFDB:P01893	0.830	0.836	2.356E-57	362	0.849	0.856	P01893.pdb.gz	HLAH_HUMAN Putative HLA class I histocompatibility antigen, alpha chain H OS=Homo sapiens OX=9606 GN=HLA-H PE=5 SV=3
4	AFDB:P10321	0.877	0.874	4.657E-56	366	0.816	0.814	P10321.pdb.gz	HLAC_HUMAN HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3
5	AFDB:A0A583ZBW8	0.868	0.865	8.370E-56	366	0.819	0.817	A0A583ZBW8.pdb.gz	A0A583ZBW8_HUMAN HLA-C protein OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
6	AFDB:P17693	0.898	0.969	8.370E-56	338	0.764	0.825	P17693.pdb.gz	HLAG_HUMAN HLA class I histocompatibility antigen, alpha chain G OS=Homo sapiens OX=9606 GN=HLA-G PE=1 SV=1
7	AFDB:P30511	0.848	0.893	7.438E-55	346	0.759	0.801	P30511.pdb.gz	HLAF_HUMAN HLA class I histocompatibility antigen, alpha chain F OS=Homo sapiens OX=9606 GN=HLA-F PE=1 SV=3
8	AFDB:P13747	0.780	0.795	2.505E-53	358	0.764	0.779	P13747.pdb.gz	HLAE_HUMAN HLA class I histocompatibility antigen, alpha chain E OS=Homo sapiens OX=9606 GN=HLA-E PE=1 SV=4
9	AFDB:Q95476	0.798	0.820	5.007E-53	355	0.721	0.741	Q95476.pdb.gz	Q95476_BOVIN MHC Class I (Fragment) OS=Bos taurus OX=9913 GN=JSP.1 PE=2 SV=1
10	AFDB:P01902	0.803	0.796	3.555E-51	368	0.685	0.679	P01902.pdb.gz	HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
11	PDB:6d7gA	0.738	0.698	5.923E-47	386	0.701	0.663	6d7gA.pdb.gz
12	PDB:6e1iA	0.747	0.702	1.374E-45	389	0.660	0.620	6e1iA.pdb.gz
13	PDB:5j6hA	0.743	0.983	1.807E-41	275	0.584	0.775	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
14	PDB:2qriA	0.731	0.671	9.319E-40	398	0.553	0.508	2qriA.pdb.gz
15	PDB:3nwmA	0.731	0.696	6.345E-39	384	0.553	0.526	3nwmA.pdb.gz
16	PDB:6mp0A	0.729	0.687	9.214E-39	388	0.537	0.505	6mp0A.pdb.gz
17	PDB:3es6A	0.619	0.790	2.074E-25	277	0.279	0.368	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
18	PDB:6fgbA	0.602	0.801	5.229E-22	265	0.197	0.272	6fgbA.pdb.gz
19	PDB:3ov6A	0.600	0.584	3.630E-18	376	0.167	0.162	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation
20	PDB:1cd1A	0.586	0.753	2.900E-17	273	0.170	0.227	1cd1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A583ZBW8	0.0	573	366	0.814	0.811	A0A583ZBW8_HUMAN HLA-C protein OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
2	P01889	0.0	581	362	0.849	0.856	HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
3	P01893	0.0	602	362	0.849	0.856	HLAH_HUMAN Putative HLA class I histocompatibility antigen, alpha chain H OS=Homo sapiens OX=9606 GN=HLA-H PE=5 SV=3
4	P04439	0.0	756	365	1.000	1.000	HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2
5	P10321	0.0	553	366	0.808	0.806	HLAC_HUMAN HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3
6	P13747	0.0	520	358	0.732	0.746	HLAE_HUMAN HLA class I histocompatibility antigen, alpha chain E OS=Homo sapiens OX=9606 GN=HLA-E PE=1 SV=4
7	P17693	0.0	570	338	0.767	0.828	HLAG_HUMAN HLA class I histocompatibility antigen, alpha chain G OS=Homo sapiens OX=9606 GN=HLA-G PE=1 SV=1
8	P30511	0.0	518	346	0.759	0.801	HLAF_HUMAN HLA class I histocompatibility antigen, alpha chain F OS=Homo sapiens OX=9606 GN=HLA-F PE=1 SV=3
9	Q53YP1	0.0	592	366	0.841	0.839	Q53YP1_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
10	Q5RIP0	0.0	597	366	0.833	0.831	Q5RIP0_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
11	Q5SUL5	0.0	703	365	0.959	0.959	Q5SUL5_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=1
12	Q7YQB1	0.0	568	366	0.836	0.833	Q7YQB1_HUMAN MHC class I antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
13	Q95476	1.91e-180	506	355	0.671	0.690	Q95476_BOVIN MHC Class I (Fragment) OS=Bos taurus OX=9913 GN=JSP.1 PE=2 SV=1
14	P01901	1.27e-169	479	369	0.679	0.672	HA1B_MOUSE H-2 class I histocompatibility antigen, K-B alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
15	P01900	3.19e-169	478	365	0.685	0.685	HA12_MOUSE H-2 class I histocompatibility antigen, D-D alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
16	P01897	5.58e-169	477	362	0.685	0.691	HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain OS=Mus musculus OX=10090 GN=H2-L PE=1 SV=2
17	P01902	3.34e-168	475	368	0.685	0.679	HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
18	P14427	4.00e-167	473	368	0.674	0.668	HA14_MOUSE H-2 class I histocompatibility antigen, D-P alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
19	P03991	8.00e-166	469	368	0.677	0.671	HA1W_MOUSE H-2 class I histocompatibility antigen, K-W28 alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=2
20	P01899	8.50e-166	469	362	0.671	0.677	HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	1.5e-11	55.8	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	7	18.1	CD80-like C2-set immunoglobulin domain
3	PF02656 DUF202	65	15.4	Domain of unknown function (DUF202)
4	PF00047 ig	12	17.5	Immunoglobulin domain
5	PF13927 Ig_3	0.0086	27.9	Immunoglobulin domain
6	PF00129 MHC_I	1e-91	316.9	Class I Histocompatibility antigen, domains alpha 1 and 2
7	PF16497 MHC_I_3	7.7	17.5	MHC-I family domain
8	PF06623 MHC_I_C	2.7e-13	60.7	MHC_I C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379873

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000404833	0.999	Tapasin
2	9606.ENSP00000452780	0.999	Beta-2-microglobulin
3	9606.ENSP00000375608	0.998	Killer cell immunoglobulin-like receptor 3DL1
4	9606.ENSP00000325525	0.995	Killer cell immunoglobulin-like receptor 3DL2
5	9606.ENSP00000300289	0.993	Protein disulfide-isomerase A3
6	9606.ENSP00000315997	0.992	Leukocyte immunoglobulin-like receptor subfamily B member 1
7	9606.ENSP00000386559	0.992	T-cell surface glycoprotein CD8 alpha chain
8	9606.ENSP00000320866	0.990	Calreticulin
9	9606.ENSP00000342215	0.983	Killer cell immunoglobulin-like receptor 2DL3
10	9606.ENSP00000438038	0.978	NKG2-A/NKG2-B type II integral membrane protein
11	9606.ENSP00000259951	0.969	HLA class I histocompatibility antigen, alpha chain F
12	9606.ENSP00000371333	0.969	Natural killer cells antigen CD94
13	9606.ENSP00000363976	0.968	HLA class II histocompatibility antigen, DM alpha chain
14	9606.ENSP00000339398	0.964	Major histocompatibility complex, class II, DQ alpha 1
15	9606.ENSP00000346206	0.964	Antigen peptide transporter 1
16	9606.ENSP00000226730	0.963	Interleukin-2
17	9606.ENSP00000364016	0.963	Proteasome subunit beta type-8
18	9606.ENSP00000365402	0.962	HLA class I histocompatibility antigen, Cw-7 alpha chain
19	9606.ENSP00000371327	0.962	NKG2-C type II integral membrane protein
20	9606.ENSP00000229829	0.959	HLA class II histocompatibility antigen, DO alpha chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003823	0.926	antigen binding
GO:0042277	0.905	peptide binding
GO:0042605	0.820	peptide antigen binding
GO:0005102	0.710	signaling receptor binding
GO:0044877	0.553	protein-containing complex binding
GO:0030881	0.441	beta-2-microglobulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0050794	0.994	regulation of cellular process
GO:0048518	0.992	positive regulation of biological process
GO:0002376	0.988	immune system process
GO:0009987	0.986	cellular process
GO:0050776	0.985	regulation of immune response
GO:0048584	0.982	positive regulation of response to stimulus
GO:0002684	0.980	positive regulation of immune system process
GO:0048522	0.978	positive regulation of cellular process
GO:0001912	0.972	positive regulation of leukocyte mediated cytotoxicity
GO:0006955	0.970	immune response
GO:0001914	0.969	regulation of T cell mediated cytotoxicity
GO:0002711	0.969	positive regulation of T cell mediated immunity
GO:0019882	0.966	antigen processing and presentation
GO:0048519	0.965	negative regulation of biological process
GO:0048002	0.964	antigen processing and presentation of peptide antigen
GO:0002683	0.949	negative regulation of immune system process
GO:0002252	0.942	immune effector process
GO:0002250	0.936	adaptive immune response
GO:0048523	0.910	negative regulation of cellular process
GO:0002449	0.908	lymphocyte mediated immunity
GO:0001906	0.907	cell killing
GO:0002698	0.896	negative regulation of immune effector process
GO:0002704	0.893	negative regulation of leukocyte mediated immunity
GO:0006952	0.886	defense response
GO:0002831	0.867	regulation of response to biotic stimulus
GO:0045088	0.829	regulation of innate immune response
GO:0002707	0.824	negative regulation of lymphocyte mediated immunity
GO:0001817	0.816	regulation of cytokine production
GO:0032102	0.765	negative regulation of response to external stimulus
GO:0050777	0.752	negative regulation of immune response
GO:0001819	0.749	positive regulation of cytokine production
GO:0009605	0.730	response to external stimulus
GO:0031348	0.726	negative regulation of defense response
GO:0002715	0.711	regulation of natural killer cell mediated immunity
GO:0045824	0.698	negative regulation of innate immune response
GO:0042269	0.697	regulation of natural killer cell mediated cytotoxicity
GO:0009607	0.687	response to biotic stimulus
GO:0098542	0.677	defense response to other organism
GO:0031342	0.643	negative regulation of cell killing
GO:0051716	0.616	cellular response to stimulus
GO:0001909	0.610	leukocyte mediated cytotoxicity
GO:0001911	0.603	negative regulation of leukocyte mediated cytotoxicity
GO:0032501	0.593	multicellular organismal process
GO:0002460	0.589	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002700	0.524	regulation of production of molecular mediator of immune response
GO:0002456	0.492	T cell mediated immunity
GO:0002718	0.486	regulation of cytokine production involved in immune response
GO:0002702	0.486	positive regulation of production of molecular mediator of immune response
GO:0002720	0.438	positive regulation of cytokine production involved in immune response
GO:0007154	0.431	cell communication
GO:0023052	0.429	signaling
GO:0050865	0.414	regulation of cell activation
GO:0007165	0.414	signal transduction
GO:0002694	0.401	regulation of leukocyte activation
GO:0051249	0.393	regulation of lymphocyte activation
GO:0009617	0.386	response to bacterium
GO:0007166	0.372	cell surface receptor signaling pathway
GO:0001916	0.356	positive regulation of T cell mediated cytotoxicity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005886	0.999	plasma membrane
GO:0098588	0.998	bounding membrane of organelle
GO:0030659	0.997	cytoplasmic vesicle membrane
GO:0009986	0.996	cell surface
GO:0031984	0.991	organelle subcompartment
GO:0005783	0.991	endoplasmic reticulum
GO:0005789	0.978	endoplasmic reticulum membrane
GO:0032991	0.973	protein-containing complex
GO:0030666	0.972	endocytic vesicle membrane
GO:0098553	0.972	lumenal side of endoplasmic reticulum membrane
GO:0043230	0.970	extracellular organelle
GO:0030670	0.963	phagocytic vesicle membrane
GO:0005794	0.960	Golgi apparatus
GO:0005768	0.959	endosome
GO:0000139	0.944	Golgi membrane
GO:0012507	0.936	ER to Golgi transport vesicle membrane
GO:0031901	0.935	early endosome membrane
GO:0055038	0.932	recycling endosome membrane
GO:0005615	0.876	extracellular space
GO:1903561	0.856	extracellular vesicle
GO:0070062	0.746	extracellular exosome
GO:0005634	0.657	nucleus
GO:0098796	0.593	membrane protein complex
GO:0000323	0.443	lytic vacuole
GO:0005764	0.403	lysosome
GO:0099503	0.388	secretory vesicle
GO:0030667	0.379	secretory granule membrane
GO:0098852	0.366	lytic vacuole membrane
GO:0042611	0.361	MHC protein complex
GO:0009897	0.334	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]