StarFunc result for job id P04440

User Input

>input (258 residues)
MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYN
REEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQR
RVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDW
TFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC
GVGIFMHRRSKKVQRGSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1C3PI11	0.799	0.799	2.895E-41	258	0.953	0.953	A0A1C3PI11.pdb.gz	A0A1C3PI11_HUMAN HLA class II histocompatibility antigen DP beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
2	AFDB:P01920	0.774	0.766	2.981E-34	261	0.612	0.605	P01920.pdb.gz	DQB1_HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQB1 PE=1 SV=2
3	AFDB:Q30154	0.750	0.730	1.223E-32	266	0.593	0.575	Q30154.pdb.gz	DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain OS=Homo sapiens OX=9606 GN=HLA-DRB5 PE=1 SV=1
4	AFDB:P13762	0.752	0.732	3.996E-32	266	0.581	0.564	P13762.pdb.gz	DRB4_HUMAN HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2
5	AFDB:A0A0G4PYZ0	0.723	0.703	1.238E-31	266	0.605	0.586	A0A0G4PYZ0.pdb.gz	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1
6	AFDB:P05538	0.698	0.676	2.928E-31	268	0.605	0.582	P05538.pdb.gz	DQB2_HUMAN HLA class II histocompatibility antigen, DQ beta 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQB2 PE=1 SV=2
7	AFDB:P79483	0.702	0.682	3.832E-31	266	0.593	0.575	P79483.pdb.gz	DRB3_HUMAN HLA class II histocompatibility antigen, DR beta 3 chain OS=Homo sapiens OX=9606 GN=HLA-DRB3 PE=1 SV=1
8	AFDB:P18211	0.639	0.628	6.928E-31	264	0.574	0.561	P18211.pdb.gz	HB2D_RAT Rano class II histocompatibility antigen, D-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Db1 PE=2 SV=1
9	AFDB:P01921	0.749	0.731	9.569E-31	265	0.593	0.577	P01921.pdb.gz	HB2D_MOUSE H-2 class II histocompatibility antigen, A-D beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
10	AFDB:P29826	0.637	0.627	9.569E-31	263	0.581	0.570	P29826.pdb.gz	HB2B_RAT Rano class II histocompatibility antigen, B-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Bb PE=1 SV=1
11	PDB:3es6A	0.515	0.486	7.948E-13	277	0.194	0.181	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
12	PDB:6cplA	0.376	0.529	2.332E-12	180	0.178	0.256	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
13	PDB:5j6hA	0.427	0.407	1.172E-11	275	0.198	0.185	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
14	PDB:6d7gA	0.378	0.282	7.309E-11	386	0.186	0.124	6d7gA.pdb.gz
15	PDB:6fgbA	0.488	0.477	1.471E-10	265	0.174	0.170	6fgbA.pdb.gz
16	PDB:6e1iA	0.388	0.287	1.825E-10	389	0.182	0.121	6e1iA.pdb.gz
17	PDB:1cd1A	0.506	0.483	2.521E-10	273	0.182	0.172	1cd1A.pdb.gz
18	PDB:6mp0A	0.393	0.290	9.173E-10	388	0.190	0.126	6mp0A.pdb.gz
19	PDB:2qriA	0.444	0.315	1.658E-9	398	0.182	0.118	2qriA.pdb.gz
20	PDB:3s6cA	0.476	0.352	1.658E-9	372	0.198	0.137	3s6cA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1C3PI11	0.0	514	258	0.953	0.953	A0A1C3PI11_HUMAN HLA class II histocompatibility antigen DP beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
2	P04440	0.0	541	258	1.000	1.000	DPB1_HUMAN HLA class II histocompatibility antigen, DP beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
3	Q30059	0.0	515	258	0.946	0.946	Q30059_HUMAN MHC class II lymphocyte antigen beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=2 SV=1
4	Q95HA4	0.0	512	257	0.950	0.953	Q95HA4_HUMAN HLA-DPB1 protein OS=Homo sapiens OX=9606 PE=1 SV=1
5	P01920	6.08e-109	317	261	0.612	0.605	DQB1_HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQB1 PE=1 SV=2
6	P01911	2.11e-108	315	266	0.624	0.605	DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=2
7	P01921	1.68e-107	313	265	0.612	0.596	HB2D_MOUSE H-2 class II histocompatibility antigen, A-D beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
8	P06342	8.10e-107	311	265	0.605	0.589	HB2Q_MOUSE H-2 class II histocompatibility antigen, A-Q beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
9	P18468	2.44e-106	310	264	0.589	0.576	HB2I_MOUSE H-2 class II histocompatibility antigen, I-A beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
10	A0A0G4PYZ0	5.38e-106	309	266	0.609	0.590	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1
11	P05538	3.27e-105	307	268	0.612	0.590	DQB2_HUMAN HLA class II histocompatibility antigen, DQ beta 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQB2 PE=1 SV=2
12	P14483	6.21e-105	306	265	0.605	0.589	HB2A_MOUSE H-2 class II histocompatibility antigen, A beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
13	P18469	4.79e-104	304	264	0.601	0.587	HB2J_MOUSE H-2 class II histocompatibility antigen, I-E beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
14	P29826	1.27e-103	303	263	0.581	0.570	HB2B_RAT Rano class II histocompatibility antigen, B-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Bb PE=1 SV=1
15	P79483	9.08e-103	301	266	0.597	0.579	DRB3_HUMAN HLA class II histocompatibility antigen, DR beta 3 chain OS=Homo sapiens OX=9606 GN=HLA-DRB3 PE=1 SV=1
16	Q30154	1.32e-102	301	266	0.566	0.549	DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain OS=Homo sapiens OX=9606 GN=HLA-DRB5 PE=1 SV=1
17	P06345	2.73e-102	300	263	0.589	0.578	HB2S_MOUSE H-2 class II histocompatibility antigen, A-S beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
18	P06346	2.60e-100	294	252	0.574	0.587	HB2F_MOUSE H-2 class II histocompatibility antigen, A-F beta chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
19	P13762	3.14e-100	295	266	0.589	0.571	DRB4_HUMAN HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2
20	P18211	2.12e-99	293	264	0.578	0.564	HB2D_RAT Rano class II histocompatibility antigen, D-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Db1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	7.6e-25	98.4	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	12	17.4	CD80-like C2-set immunoglobulin domain
3	PF00047 ig	3.5	19.2	Immunoglobulin domain
4	PF13895 Ig_2	14	17.4	Immunoglobulin domain
5	PF13927 Ig_3	0.12	24.3	Immunoglobulin domain
6	PF02124 Marek_A	2.6	19.8	Marek's disease glycoprotein A
7	PF00969 MHC_II_beta	2e-30	116.1	Class II histocompatibility antigen, beta domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000408146

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000393566	0.996	HLA class II histocompatibility antigen, DP alpha 1 chain
2	9606.ENSP00000363976	0.978	HLA class II histocompatibility antigen, DM alpha chain
3	9606.ENSP00000378786	0.961	HLA class II histocompatibility antigen, DR alpha chain
4	9606.ENSP00000398890	0.949	HLA class II histocompatibility antigen, DM beta chain
5	9606.ENSP00000229829	0.947	HLA class II histocompatibility antigen, DO alpha chain
6	9606.ENSP00000352833	0.945	Tyrosine-protein phosphatase non-receptor type 22
7	9606.ENSP00000399168	0.935	HLA class I histocompatibility antigen, B-7 alpha chain
8	9606.ENSP00000353099	0.934	HLA class II histocompatibility antigen, DRB1-15 beta chain
9	9606.ENSP00000365402	0.934	HLA class I histocompatibility antigen, Cw-7 alpha chain
10	9606.ENSP00000379873	0.934	HLA class I histocompatibility antigen, A-3 alpha chain
11	9606.ENSP00000365817	0.931	HLA class I histocompatibility antigen, alpha chain E
12	9606.ENSP00000259951	0.928	HLA class I histocompatibility antigen, alpha chain F
13	9606.ENSP00000357981	0.927	Cathepsin S
14	9606.ENSP00000445052	0.927	Cathepsin L2
15	9606.ENSP00000009530	0.924	HLA class II histocompatibility antigen gamma chain
16	9606.ENSP00000370989	0.920	Programmed cell death 1 ligand 1
17	9606.ENSP00000411355	0.920	Receptor-type tyrosine-protein phosphatase C
18	9606.ENSP00000220166	0.918	Pro-cathepsin H
19	9606.ENSP00000335062	0.918	Programmed cell death protein 1
20	9606.ENSP00000390020	0.912	HLA class II histocompatibility antigen, DO beta chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003823	0.660	antigen binding
GO:0042605	0.399	peptide antigen binding
GO:0038023	0.342	signaling receptor activity
GO:0004888	0.324	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0050789	0.981	regulation of biological process
GO:0002504	0.975	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
GO:0019886	0.973	antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0002682	0.958	regulation of immune system process
GO:0009987	0.931	cellular process
GO:0050794	0.883	regulation of cellular process
GO:0048518	0.605	positive regulation of biological process
GO:0006955	0.512	immune response
GO:0048522	0.491	positive regulation of cellular process
GO:0002684	0.483	positive regulation of immune system process
GO:0051716	0.481	cellular response to stimulus
GO:0050776	0.481	regulation of immune response
GO:0019222	0.464	regulation of metabolic process
GO:0007165	0.448	signal transduction
GO:0048584	0.447	positive regulation of response to stimulus
GO:0051249	0.441	regulation of lymphocyte activation
GO:0060255	0.430	regulation of macromolecule metabolic process
GO:0050863	0.416	regulation of T cell activation
GO:0050778	0.407	positive regulation of immune response
GO:0048519	0.358	negative regulation of biological process
GO:0030155	0.357	regulation of cell adhesion
GO:1903037	0.347	regulation of leukocyte cell-cell adhesion
GO:1903039	0.327	positive regulation of leukocyte cell-cell adhesion
GO:0051251	0.325	positive regulation of lymphocyte activation
GO:0007166	0.323	cell surface receptor signaling pathway
GO:0050870	0.314	positive regulation of T cell activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0031410	0.999	cytoplasmic vesicle
GO:0031090	0.996	organelle membrane
GO:0098797	0.996	plasma membrane protein complex
GO:0098552	0.994	side of membrane
GO:0098588	0.994	bounding membrane of organelle
GO:0030659	0.988	cytoplasmic vesicle membrane
GO:0009986	0.986	cell surface
GO:0005794	0.982	Golgi apparatus
GO:0098852	0.978	lytic vacuole membrane
GO:0031984	0.977	organelle subcompartment
GO:0005765	0.974	lysosomal membrane
GO:0042611	0.971	MHC protein complex
GO:0005789	0.970	endoplasmic reticulum membrane
GO:0012507	0.967	ER to Golgi transport vesicle membrane
GO:0030136	0.964	clathrin-coated vesicle
GO:0030666	0.961	endocytic vesicle membrane
GO:0042613	0.954	MHC class II protein complex
GO:0000139	0.951	Golgi membrane
GO:0098553	0.945	lumenal side of endoplasmic reticulum membrane
GO:0005802	0.938	trans-Golgi network
GO:0030669	0.937	clathrin-coated endocytic vesicle membrane
GO:0032588	0.933	trans-Golgi network membrane
GO:0005768	0.815	endosome
GO:0010008	0.671	endosome membrane
GO:0005576	0.665	extracellular region
GO:1903561	0.659	extracellular vesicle
GO:0070062	0.654	extracellular exosome
GO:0009897	0.475	external side of plasma membrane
GO:0005770	0.470	late endosome
GO:0005769	0.384	early endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]