StarFunc result for job id P04628

User Input

>input (370 residues)
MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91029	0.953	0.958	4.863E-60	368	0.868	0.872	Q91029.pdb.gz	WNT1_CHICK Protein Wnt-1 OS=Gallus gallus OX=9031 GN=WNT1 PE=1 SV=3
2	AFDB:D4A9J2	0.922	0.922	5.151E-59	370	0.986	0.986	D4A9J2.pdb.gz	D4A9J2_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt1 PE=3 SV=1
3	AFDB:P24257	0.944	0.944	3.076E-54	370	0.746	0.746	P24257.pdb.gz	WNT1_DANRE Protein Wnt-1 OS=Danio rerio OX=7955 GN=wnt1 PE=2 SV=1
4	AFDB:P10108	0.902	0.900	4.502E-50	371	0.684	0.682	P10108.pdb.gz	WNT1_XENLA Protein Wnt-1 OS=Xenopus laevis OX=8355 GN=wnt1 PE=2 SV=1
5	AFDB:P09615	0.842	0.672	2.186E-39	468	0.557	0.440	P09615.pdb.gz	WNTG_DROME Protein wingless OS=Drosophila melanogaster OX=7227 GN=wg PE=1 SV=1
6	AFDB:P27467	0.841	0.882	5.027E-35	352	0.427	0.449	P27467.pdb.gz	WNT3A_MOUSE Protein Wnt-3a OS=Mus musculus OX=10090 GN=Wnt3a PE=1 SV=1
7	AFDB:P31285	0.842	0.883	1.372E-34	352	0.414	0.435	P31285.pdb.gz	WNT3A_XENLA Protein Wnt-3a OS=Xenopus laevis OX=8355 GN=wnt3a PE=1 SV=1
8	AFDB:P09544	0.813	0.834	1.678E-34	360	0.397	0.408	P09544.pdb.gz	WNT2_HUMAN Protein Wnt-2 OS=Homo sapiens OX=9606 GN=WNT2 PE=2 SV=1
9	AFDB:P49337	0.836	0.879	6.509E-34	351	0.408	0.430	P49337.pdb.gz	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
10	AFDB:Q9YGX6	0.811	0.781	8.367E-34	385	0.386	0.371	Q9YGX6.pdb.gz	Q9YGX6_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT5A PE=2 SV=1
11	PDB:6ahyB	0.723	0.846	2.819E-29	313	0.392	0.463	6ahyB.pdb.gz
12	PDB:4f0aB	0.644	0.795	1.957E-24	294	0.314	0.395	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
13	PDB:7qbgA	0.115	0.113	8.990E-1	381	0.062	0.060	7qbgA.pdb.gz	Generation of nanobodies targeting the human, transcobalamin-mediated vitamin B 12 uptake route.
14	PDB:7c7sA	0.138	0.092	1.156	685	0.065	0.035	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
15	PDB:7w56R	0.122	0.147	1.727	276	0.051	0.069	7w56R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
16	PDB:1k62B	0.094	0.079	2.220	459	0.086	0.070	1k62B.pdb.gz
17	PDB:5voxR	0.097	0.148	2.220	213	0.057	0.099	5voxR.pdb.gz
18	PDB:6w2xB	0.119	0.079	2.220	669	0.046	0.025	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
19	PDB:4w8yA	0.170	0.085	2.334	835	0.038	0.017	4w8yA.pdb.gz	Structural Model of a CRISPR RNA-Silencing Complex Reveals the RNA-Target Cleavage Activity in Cmr4.
20	PDB:4flcB	0.119	0.100	2.853	464	0.081	0.065	4flcB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A9J2	0.0	748	370	0.986	0.986	D4A9J2_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt1 PE=3 SV=1
2	P04426	0.0	750	370	0.989	0.989	WNT1_MOUSE Proto-oncogene Wnt-1 OS=Mus musculus OX=10090 GN=Wnt1 PE=1 SV=1
3	P04628	0.0	755	370	1.000	1.000	WNT1_HUMAN Proto-oncogene Wnt-1 OS=Homo sapiens OX=9606 GN=WNT1 PE=1 SV=1
4	P10108	0.0	544	371	0.692	0.690	WNT1_XENLA Protein Wnt-1 OS=Xenopus laevis OX=8355 GN=wnt1 PE=2 SV=1
5	P24257	0.0	593	370	0.743	0.743	WNT1_DANRE Protein Wnt-1 OS=Danio rerio OX=7955 GN=wnt1 PE=2 SV=1
6	Q91029	0.0	660	368	0.854	0.859	WNT1_CHICK Protein Wnt-1 OS=Gallus gallus OX=9031 GN=WNT1 PE=1 SV=3
7	P49338	2.01e-107	320	351	0.424	0.447	WNT4_XENLA Protein Wnt-4 OS=Xenopus laevis OX=8355 GN=wnt4 PE=2 SV=1
8	P49337	3.59e-105	315	351	0.422	0.444	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
9	P56705	1.85e-104	313	351	0.435	0.459	WNT4_HUMAN Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1 SV=4
10	P22724	1.10e-103	311	351	0.432	0.456	WNT4_MOUSE Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1
11	D3ZCR1	1.19e-103	311	355	0.419	0.437	D3ZCR1_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt3 PE=3 SV=1
12	P17553	1.19e-103	311	355	0.419	0.437	WNT3_MOUSE Proto-oncogene Wnt-3 OS=Mus musculus OX=10090 GN=Wnt3 PE=1 SV=1
13	P27467	1.51e-103	311	352	0.435	0.457	WNT3A_MOUSE Protein Wnt-3a OS=Mus musculus OX=10090 GN=Wnt3a PE=1 SV=1
14	Q9QXQ5	2.00e-103	310	351	0.432	0.456	WNT4_RAT Protein Wnt-4 OS=Rattus norvegicus OX=10116 GN=Wnt4 PE=2 SV=1
15	A1DYI3	3.09e-103	310	355	0.416	0.434	A1DYI3_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=Wnt3 PE=2 SV=1
16	Q6IYD9	3.39e-103	310	365	0.427	0.433	Q6IYD9_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=Zwnt[a] PE=2 SV=1
17	P56703	3.52e-103	310	355	0.419	0.437	WNT3_HUMAN Proto-oncogene Wnt-3 OS=Homo sapiens OX=9606 GN=WNT3 PE=1 SV=2
18	P47793	5.26e-103	309	352	0.414	0.435	WNT4A_DANRE Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=2 SV=1
19	Q2LMP1	2.57e-102	308	352	0.427	0.449	WNT3A_CHICK Protein Wnt-3a OS=Gallus gallus OX=9031 GN=WNT3A PE=1 SV=1
20	P31285	3.52e-101	305	352	0.416	0.438	WNT3A_XENLA Protein Wnt-3a OS=Xenopus laevis OX=8355 GN=wnt3a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00110 wnt	1.1e-116	401.3	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010383724.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010369300.1	0.991	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.
2	61622.XP_010352954.1	0.989	Frizzled-1
3	61622.XP_010364779.1	0.986	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.
4	61622.XP_010352284.1	0.982	Belongs to the G-protein coupled receptor Fz/Smo family.
5	61622.XP_010384367.1	0.980	Belongs to the G-protein coupled receptor Fz/Smo family.
6	61622.XP_010385200.1	0.980	Belongs to the G-protein coupled receptor Fz/Smo family.
7	61622.XP_010352827.1	0.977	Belongs to the G-protein coupled receptor Fz/Smo family.
8	61622.XP_010385756.1	0.976	Belongs to the G-protein coupled receptor Fz/Smo family.
9	61622.XP_010354330.1	0.975	Belongs to the G-protein coupled receptor Fz/Smo family.
10	61622.XP_010359407.1	0.975	Belongs to the membrane-bound acyltransferase family.
11	61622.XP_010372596.1	0.973	Catenin beta-1
12	61622.XP_010353283.1	0.971	Belongs to the G-protein coupled receptor Fz/Smo family.
13	61622.XP_010355368.1	0.967	Wntless Wnt ligand secretion mediator
14	61622.XP_010369211.1	0.963	Belongs to the G-protein coupled receptor Fz/Smo family.
15	61622.XP_010352909.1	0.946	Secreted frizzled-related protein 1
16	61622.XP_010385211.1	0.941	Wnt inhibitory factor 1
17	61622.XP_010379901.1	0.936	Dickkopf WNT signaling pathway inhibitor 1
18	61622.XP_010387719.1	0.936	Belongs to the G-protein coupled receptor Fz/Smo family.
19	61622.XP_010362654.1	0.934	Ligand for members of the frizzled family of seven transmembrane receptors
20	61622.XP_010353568.1	0.918	Segment polarity protein dishevelled homolog DVL-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	0.999	receptor ligand activity
GO:0005109	0.946	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0032502	0.995	developmental process
GO:0051716	0.995	cellular response to stimulus
GO:0048856	0.992	anatomical structure development
GO:0032501	0.991	multicellular organismal process
GO:0007165	0.985	signal transduction
GO:0048518	0.983	positive regulation of biological process
GO:0007166	0.978	cell surface receptor signaling pathway
GO:0007267	0.975	cell-cell signaling
GO:0048522	0.971	positive regulation of cellular process
GO:0016055	0.970	Wnt signaling pathway
GO:0019222	0.967	regulation of metabolic process
GO:0007275	0.965	multicellular organism development
GO:0060070	0.961	canonical Wnt signaling pathway
GO:0048731	0.934	system development
GO:0048869	0.909	cellular developmental process
GO:0048513	0.906	animal organ development
GO:0023051	0.896	regulation of signaling
GO:0010646	0.896	regulation of cell communication
GO:0009719	0.892	response to endogenous stimulus
GO:0030154	0.892	cell differentiation
GO:0051171	0.884	regulation of nitrogen compound metabolic process
GO:0031323	0.881	regulation of cellular metabolic process
GO:0080090	0.880	regulation of primary metabolic process
GO:0050793	0.878	regulation of developmental process
GO:0009653	0.878	anatomical structure morphogenesis
GO:0009888	0.868	tissue development
GO:0048519	0.867	negative regulation of biological process
GO:0060255	0.863	regulation of macromolecule metabolic process
GO:0009966	0.848	regulation of signal transduction
GO:0070848	0.822	response to growth factor
GO:0009893	0.812	positive regulation of metabolic process
GO:0007399	0.811	nervous system development
GO:0048523	0.806	negative regulation of cellular process
GO:0010604	0.780	positive regulation of macromolecule metabolic process
GO:0010468	0.762	regulation of gene expression
GO:0071495	0.755	cellular response to endogenous stimulus
GO:0051093	0.747	negative regulation of developmental process
GO:0051094	0.744	positive regulation of developmental process
GO:0045595	0.735	regulation of cell differentiation
GO:0042981	0.727	regulation of apoptotic process
GO:0071542	0.725	dopaminergic neuron differentiation
GO:0051239	0.724	regulation of multicellular organismal process
GO:0051128	0.706	regulation of cellular component organization
GO:0010033	0.705	response to organic substance
GO:0007167	0.688	enzyme-linked receptor protein signaling pathway
GO:0051173	0.683	positive regulation of nitrogen compound metabolic process
GO:0009889	0.678	regulation of biosynthetic process
GO:0010628	0.674	positive regulation of gene expression
GO:0031326	0.658	regulation of cellular biosynthetic process
GO:0019219	0.657	regulation of nucleobase-containing compound metabolic process
GO:0045596	0.640	negative regulation of cell differentiation
GO:0009892	0.635	negative regulation of metabolic process
GO:0009887	0.623	animal organ morphogenesis
GO:0031325	0.588	positive regulation of cellular metabolic process
GO:0051252	0.553	regulation of RNA metabolic process
GO:0051130	0.547	positive regulation of cellular component organization
GO:0044087	0.545	regulation of cellular component biogenesis
GO:0001822	0.543	kidney development
GO:0010556	0.538	regulation of macromolecule biosynthetic process
GO:0035295	0.531	tube development
GO:0009891	0.497	positive regulation of biosynthetic process
GO:0042127	0.494	regulation of cell population proliferation
GO:0060429	0.493	epithelium development
GO:0006355	0.483	regulation of DNA-templated transcription
GO:0072073	0.477	kidney epithelium development
GO:0048584	0.462	positive regulation of response to stimulus
GO:0044089	0.455	positive regulation of cellular component biogenesis
GO:1903508	0.449	positive regulation of nucleic acid-templated transcription
GO:0007420	0.447	brain development
GO:0045893	0.443	positive regulation of DNA-templated transcription
GO:0048732	0.414	gland development
GO:1901698	0.411	response to nitrogen compound
GO:0008152	0.387	metabolic process
GO:0065009	0.371	regulation of molecular function
GO:0002009	0.363	morphogenesis of an epithelium
GO:0003002	0.358	regionalization
GO:0071704	0.344	organic substance metabolic process
GO:0008284	0.344	positive regulation of cell population proliferation
GO:0010605	0.340	negative regulation of macromolecule metabolic process
GO:0051246	0.324	regulation of protein metabolic process
GO:0071363	0.321	cellular response to growth factor stimulus
GO:0009967	0.317	positive regulation of signal transduction
GO:0009790	0.311	embryo development
GO:0044238	0.307	primary metabolic process
GO:0030901	0.307	midbrain development
GO:0001823	0.305	mesonephros development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005576	1.000	extracellular region
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	0.999	intracellular organelle lumen
GO:0005886	0.981	plasma membrane
GO:0032991	0.973	protein-containing complex
GO:0005783	0.940	endoplasmic reticulum
GO:0031090	0.871	organelle membrane
GO:0005788	0.861	endoplasmic reticulum lumen
GO:0031982	0.848	vesicle
GO:0005615	0.741	extracellular space
GO:0005634	0.606	nucleus
GO:0043230	0.535	extracellular organelle
GO:0065010	0.533	extracellular membrane-bounded organelle
GO:0031410	0.533	cytoplasmic vesicle
GO:0031981	0.520	nuclear lumen
GO:0098588	0.513	bounding membrane of organelle
GO:0005794	0.512	Golgi apparatus
GO:1903561	0.507	extracellular vesicle
GO:0030659	0.459	cytoplasmic vesicle membrane
GO:0070062	0.441	extracellular exosome
GO:0009986	0.418	cell surface
GO:0005654	0.415	nucleoplasm
GO:0030139	0.379	endocytic vesicle
GO:0030666	0.307	endocytic vesicle membrane
GO:0005796	0.305	Golgi lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]