StarFunc result for job id P04629

User Input

>input (796 residues)
MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLH
HLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQ
GPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK
SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT
LLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSV
AVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTE
GKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKML
VAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQ
GLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI
FTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHAR
LQALAQAPPVYLDVLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04629	1.000	1.000	0.000	796	1.000	1.000	P04629.pdb.gz	NTRK1_HUMAN High affinity nerve growth factor receptor OS=Homo sapiens OX=9606 GN=NTRK1 PE=1 SV=4
2	AFDB:P35739	0.856	0.853	0.000	799	0.867	0.864	P35739.pdb.gz	NTRK1_RAT High affinity nerve growth factor receptor OS=Rattus norvegicus OX=10116 GN=Ntrk1 PE=1 SV=1
3	AFDB:F6P1M3	0.436	0.435	3.387E-94	797	0.534	0.533	F6P1M3.pdb.gz	F6P1M3_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=trk PE=3 SV=1
4	AFDB:Q03351	0.416	0.386	1.626E-90	864	0.518	0.477	Q03351.pdb.gz	NTRK3_RAT NT-3 growth factor receptor OS=Rattus norvegicus OX=10116 GN=Ntrk3 PE=1 SV=2
5	AFDB:Q16288	0.421	0.402	8.645E-89	839	0.518	0.491	Q16288.pdb.gz	NTRK3_HUMAN NT-3 growth factor receptor OS=Homo sapiens OX=9606 GN=NTRK3 PE=1 SV=2
6	AFDB:A0A0H2UKW5	0.424	0.416	8.895E-88	813	0.486	0.476	A0A0H2UKW5.pdb.gz	A0A0H2UKW5_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=ntrk3b PE=3 SV=5
7	AFDB:A0A0R4ITX7	0.418	0.416	2.308E-87	801	0.485	0.482	A0A0R4ITX7.pdb.gz
8	AFDB:A0A0R4ITE7	0.428	0.417	4.596E-87	821	0.499	0.484	A0A0R4ITE7.pdb.gz
9	AFDB:A0A024R230	0.422	0.403	1.018E-86	838	0.499	0.474	A0A024R230.pdb.gz
10	AFDB:Q91987	0.405	0.395	1.258E-86	818	0.491	0.478	Q91987.pdb.gz	NTRK2_CHICK BDNF/NT-3 growth factors receptor OS=Gallus gallus OX=9031 GN=NTRK2 PE=1 SV=1
11	PDB:2h8hA	0.298	0.518	2.684E-21	445	0.131	0.234	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:4fl2A	0.301	0.426	1.315E-20	555	0.116	0.166	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:4k2rA	0.294	0.419	2.619E-20	551	0.117	0.169	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:1k9aB	0.295	0.525	2.127E-18	441	0.119	0.215	1k9aB.pdb.gz
15	PDB:8dksA	0.263	0.686	4.502E-14	283	0.097	0.272	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:4btfA	0.275	0.512	1.369E-13	413	0.082	0.157	4btfA.pdb.gz
17	PDB:3eqdA	0.279	0.658	2.453E-13	315	0.088	0.222	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
18	PDB:6s73A	0.291	0.803	2.727E-13	269	0.080	0.238	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
19	PDB:7mfdA	0.272	0.501	2.727E-13	410	0.103	0.200	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
20	PDB:6lk5A	0.277	0.784	2.875E-13	265	0.085	0.257	6lk5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0H2UKW5	0.0	716	813	0.485	0.475	A0A0H2UKW5_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=ntrk3b PE=3 SV=5
2	A0A0R4ILA2	0.0	687	799	0.485	0.483	A0A0R4ILA2_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=si:ch211-220b11.1 PE=3 SV=1
3	F1QKJ0	0.0	719	818	0.486	0.473	F1QKJ0_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=trkC1 PE=3 SV=2
4	F6P1M3	0.0	838	797	0.525	0.524	F6P1M3_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=trk PE=3 SV=1
5	F7DGW1	0.0	722	838	0.505	0.480	F7DGW1_MACMU Tyrosine-protein kinase receptor OS=Macaca mulatta OX=9544 GN=NTRK2 PE=2 SV=2
6	P04629	0.0	1639	796	1.000	1.000	NTRK1_HUMAN High affinity nerve growth factor receptor OS=Homo sapiens OX=9606 GN=NTRK1 PE=1 SV=4
7	P15209	0.0	737	821	0.518	0.502	NTRK2_MOUSE BDNF/NT-3 growth factors receptor OS=Mus musculus OX=10090 GN=Ntrk2 PE=1 SV=1
8	P24786	0.0	740	825	0.499	0.481	NTRK3_PIG NT-3 growth factor receptor OS=Sus scrofa OX=9823 GN=NTRK3 PE=2 SV=1
9	P35739	0.0	1382	799	0.867	0.864	NTRK1_RAT High affinity nerve growth factor receptor OS=Rattus norvegicus OX=10116 GN=Ntrk1 PE=1 SV=1
10	Q03351	0.0	743	864	0.503	0.463	NTRK3_RAT NT-3 growth factor receptor OS=Rattus norvegicus OX=10116 GN=Ntrk3 PE=1 SV=2
11	Q16288	0.0	749	839	0.505	0.479	NTRK3_HUMAN NT-3 growth factor receptor OS=Homo sapiens OX=9606 GN=NTRK3 PE=1 SV=2
12	Q16620	0.0	732	822	0.508	0.491	NTRK2_HUMAN BDNF/NT-3 growth factors receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=1 SV=1
13	Q3UFB7	0.0	1383	799	0.871	0.867	NTRK1_MOUSE High affinity nerve growth factor receptor OS=Mus musculus OX=10090 GN=Ntrk1 PE=1 SV=2
14	Q548C2	0.0	732	822	0.508	0.491	Q548C2_HUMAN Tyrosine-protein kinase receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=2 SV=1
15	Q63604	0.0	735	821	0.494	0.479	NTRK2_RAT BDNF/NT-3 growth factors receptor OS=Rattus norvegicus OX=10116 GN=Ntrk2 PE=1 SV=1
16	Q6B515	0.0	665	669	0.433	0.516	Q6B515_TAEGU Tyrosine-protein kinase receptor (Fragment) OS=Taeniopygia guttata OX=59729 PE=2 SV=1
17	Q6VNS1	0.0	762	825	0.503	0.485	NTRK3_MOUSE NT-3 growth factor receptor OS=Mus musculus OX=10090 GN=Ntrk3 PE=1 SV=1
18	Q91987	0.0	726	818	0.503	0.489	NTRK2_CHICK BDNF/NT-3 growth factors receptor OS=Gallus gallus OX=9031 GN=NTRK2 PE=1 SV=1
19	G9JKB3	1.41e-95	311	576	0.255	0.352	G9JKB3_DANRE Neurotrophic tyrosine kinase receptor type 3a (Fragment) OS=Danio rerio OX=7955 GN=TrkC1 PE=2 SV=1
20	Q61006	1.10e-87	298	868	0.211	0.194	MUSK_MOUSE Muscle, skeletal receptor tyrosine-protein kinase OS=Mus musculus OX=10090 GN=Musk PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	4.6e-08	44.3	Immunoglobulin I-set domain
2	PF13895 Ig_2	1.1	20.9	Immunoglobulin domain
3	PF13927 Ig_3	1.3e-05	37.0	Immunoglobulin domain
4	PF16920 LRRCT_2	4.2e-11	54.0	Leucine rich repeat C-terminal motif
5	PF12799 LRR_4	6.1e+02	12.3	Leucine Rich repeats (2 copies)
6	PF13855 LRR_8	4.2e-08	44.1	Leucine rich repeat
7	PF00069 Pkinase	5.2e-39	145.8	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	1e-89	311.9	Protein tyrosine and serine/threonine kinase
9	PF18613 TrkA_TMD	4.6e-05	34.1	Tyrosine kinase receptor A trans-membrane domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000431418

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000172229	0.999	Tumor necrosis factor receptor superfamily member 16
2	9606.ENSP00000358525	0.999	Beta-nerve growth factor
3	9606.ENSP00000397297	0.999	Neurotrophin-3
4	9606.ENSP00000401303	0.999	SHC-transforming protein 1
5	9606.ENSP00000414303	0.999	Brain-derived neurotrophic factor
6	9606.ENSP00000244007	0.998	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
7	9606.ENSP00000376753	0.998	PDZ domain-containing protein GIPC1
8	9606.ENSP00000447241	0.998	Fibroblast growth factor receptor substrate 2
9	9606.ENSP00000256707	0.996	Kinase D-interacting substrate of 220 kDa
10	9606.ENSP00000222390	0.995	Hepatocyte growth factor
11	9606.ENSP00000228280	0.995	Kit ligand
12	9606.ENSP00000428340	0.995	Angiopoietin-1
13	9606.ENSP00000302665	0.994	Insulin-like growth factor I
14	9606.ENSP00000314897	0.994	Angiopoietin-2
15	9606.ENSP00000380432	0.994	Insulin
16	9606.ENSP00000478570	0.994	Vascular endothelial growth factor A
17	9606.ENSP00000374455	0.992	Sequestosome-1
18	9606.ENSP00000376345	0.991	Growth factor receptor-bound protein 2
19	9606.ENSP00000383199	0.989	E3 ubiquitin-protein ligase NEDD4-like
20	9606.ENSP00000409007	0.987	Glial cell line-derived neurotrophic factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019838	1.000	growth factor binding
GO:0004714	1.000	transmembrane receptor protein tyrosine kinase activity
GO:0046983	0.963	protein dimerization activity
GO:0042802	0.809	identical protein binding
GO:0004674	0.773	protein serine/threonine kinase activity
GO:0019899	0.769	enzyme binding
GO:0005102	0.711	signaling receptor binding
GO:0042803	0.575	protein homodimerization activity
GO:0043121	0.433	neurotrophin binding
GO:0048406	0.406	nerve growth factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0050896	0.985	response to stimulus
GO:0048518	0.978	positive regulation of biological process
GO:0023052	0.977	signaling
GO:0007154	0.976	cell communication
GO:0048522	0.972	positive regulation of cellular process
GO:0007165	0.967	signal transduction
GO:0048519	0.961	negative regulation of biological process
GO:0019222	0.956	regulation of metabolic process
GO:0006468	0.947	protein phosphorylation
GO:0032502	0.935	developmental process
GO:0048523	0.932	negative regulation of cellular process
GO:0032501	0.931	multicellular organismal process
GO:0007166	0.931	cell surface receptor signaling pathway
GO:0048856	0.927	anatomical structure development
GO:0060255	0.922	regulation of macromolecule metabolic process
GO:0070848	0.920	response to growth factor
GO:0060548	0.918	negative regulation of cell death
GO:0080090	0.907	regulation of primary metabolic process
GO:0051171	0.900	regulation of nitrogen compound metabolic process
GO:0007275	0.892	multicellular organism development
GO:0043069	0.891	negative regulation of programmed cell death
GO:0007167	0.861	enzyme-linked receptor protein signaling pathway
GO:0043066	0.851	negative regulation of apoptotic process
GO:0071363	0.835	cellular response to growth factor stimulus
GO:0030154	0.828	cell differentiation
GO:0048731	0.823	system development
GO:0042327	0.815	positive regulation of phosphorylation
GO:0001934	0.812	positive regulation of protein phosphorylation
GO:1990089	0.793	response to nerve growth factor
GO:1902533	0.784	positive regulation of intracellular signal transduction
GO:0071840	0.781	cellular component organization or biogenesis
GO:0051130	0.779	positive regulation of cellular component organization
GO:0044093	0.769	positive regulation of molecular function
GO:0042221	0.755	response to chemical
GO:0016043	0.735	cellular component organization
GO:0007399	0.691	nervous system development
GO:0051239	0.673	regulation of multicellular organismal process
GO:0050790	0.669	regulation of catalytic activity
GO:0051094	0.658	positive regulation of developmental process
GO:1901214	0.649	regulation of neuron death
GO:0043524	0.636	negative regulation of neuron apoptotic process
GO:0051240	0.626	positive regulation of multicellular organismal process
GO:2000026	0.610	regulation of multicellular organismal development
GO:0046777	0.610	protein autophosphorylation
GO:0048468	0.594	cell development
GO:0010468	0.482	regulation of gene expression
GO:0043410	0.454	positive regulation of MAPK cascade
GO:0031326	0.447	regulation of cellular biosynthetic process
GO:0007169	0.442	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0010556	0.437	regulation of macromolecule biosynthetic process
GO:0065008	0.419	regulation of biological quality
GO:1990090	0.416	cellular response to nerve growth factor stimulus
GO:0030182	0.395	neuron differentiation
GO:0019219	0.390	regulation of nucleobase-containing compound metabolic process
GO:0031175	0.377	neuron projection development
GO:0018193	0.356	peptidyl-amino acid modification
GO:0042127	0.329	regulation of cell population proliferation
GO:0006950	0.318	response to stress
GO:0051252	0.315	regulation of RNA metabolic process
GO:0006355	0.313	regulation of DNA-templated transcription
GO:0070887	0.301	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.988	endomembrane system
GO:0031982	0.961	vesicle
GO:0032991	0.838	protein-containing complex
GO:0097708	0.837	intracellular vesicle
GO:0031410	0.811	cytoplasmic vesicle
GO:0031090	0.713	organelle membrane
GO:0005768	0.584	endosome
GO:0005829	0.371	cytosol
GO:0098588	0.343	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]