StarFunc result for job id P04792

User Input

>input (205 residues)
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPP
AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI
TGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEIT
IPVTFESRAQLGGPEAAKSDETAAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04792	1.000	1.000	7.568E-37	205	1.000	1.000	P04792.pdb.gz	HSPB1_HUMAN Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2
2	AFDB:P15991	0.546	0.527	1.993E-28	213	0.844	0.812	P15991.pdb.gz	HSPB1_CRILO Heat shock protein beta-1 OS=Cricetulus longicaudatus OX=10030 GN=HSPB1 PE=1 SV=1
3	AFDB:Q00649	0.538	0.568	7.086E-24	193	0.644	0.684	Q00649.pdb.gz	HSPB1_CHICK Heat shock protein beta-1 OS=Gallus gallus OX=9031 GN=HSPB1 PE=2 SV=1
4	AFDB:A4VAK4	0.580	0.596	1.634E-22	199	0.595	0.613	A4VAK4.pdb.gz	A4VAK4_DANRE Heat shock protein beta-1 OS=Danio rerio OX=7955 GN=hsp1 PE=1 SV=1
5	PDB:6dv5A	0.346	0.387	3.302E-16	181	0.878	0.994	6dv5A.pdb.gz
6	AFDB:P82147	0.509	0.554	4.550E-14	187	0.341	0.374	P82147.pdb.gz	L2EFL_DROME Protein lethal(2)essential for life OS=Drosophila melanogaster OX=7227 GN=l(2)efl PE=1 SV=1
7	AFDB:A0A0R4IG31	0.453	0.513	2.066E-13	180	0.317	0.361	A0A0R4IG31.pdb.gz
8	AFDB:Q8UUZ6	0.447	0.524	2.585E-13	173	0.341	0.405	Q8UUZ6.pdb.gz	Q8UUZ6_DANRE Alpha A crystallin OS=Danio rerio OX=7955 GN=wu:fc06h04 PE=1 SV=1
9	AFDB:P02470	0.449	0.528	2.892E-13	173	0.312	0.370	P02470.pdb.gz	CRYAA_BOVIN Alpha-crystallin A chain OS=Bos taurus OX=9913 GN=CRYAA PE=1 SV=1
10	AFDB:P02510	0.472	0.547	2.892E-13	175	0.376	0.440	P02510.pdb.gz	CRYAB_BOVIN Alpha-crystallin B chain OS=Bos taurus OX=9913 GN=CRYAB PE=1 SV=2
11	AFDB:Q9PUR2	0.419	0.507	2.055E-12	168	0.244	0.298	Q9PUR2.pdb.gz	Q9PUR2_DANRE Alpha b crystallin OS=Danio rerio OX=7955 GN=cryab PE=1 SV=1
12	PDB:6f2rA	0.414	0.640	1.729E-10	130	0.229	0.362	6f2rA.pdb.gz	Terminal Regions Confer Plasticity to the Tetrameric Assembly of Human HspB2 and HspB3.
13	PDB:5ltwG	0.365	0.623	2.164E-10	118	0.215	0.373	5ltwG.pdb.gz
14	PDB:5ltwL	0.357	0.718	2.849E-9	100	0.210	0.430	5ltwL.pdb.gz
15	PDB:4ydzA	0.379	0.563	7.387E-9	135	0.185	0.281	4ydzA.pdb.gz
16	PDB:6t1rA	0.363	0.438	1.915E-8	166	0.278	0.343	6t1rA.pdb.gz
17	PDB:2ygdA	0.338	0.389	5.554E-8	175	0.278	0.326	2ygdA.pdb.gz
18	PDB:6f2rQ	0.370	0.828	8.180E-7	89	0.151	0.348	6f2rQ.pdb.gz	Terminal Regions Confer Plasticity to the Tetrameric Assembly of Human HspB2 and HspB3.
19	PDB:3w1zB	0.359	0.501	6.150E-6	143	0.127	0.182	3w1zB.pdb.gz
20	PDB:1gmeA	0.374	0.498	1.205E-5	150	0.102	0.140	1gmeA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P04792	1.24e-150	417	205	1.000	1.000	HSPB1_HUMAN Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2
2	P14602	3.63e-126	356	209	0.849	0.833	HSPB1_MOUSE Heat shock protein beta-1 OS=Mus musculus OX=10090 GN=Hspb1 PE=1 SV=3
3	P42930	2.49e-121	343	206	0.820	0.816	HSPB1_RAT Heat shock protein beta-1 OS=Rattus norvegicus OX=10116 GN=Hspb1 PE=1 SV=1
4	P15991	7.64e-119	337	213	0.834	0.803	HSPB1_CRILO Heat shock protein beta-1 OS=Cricetulus longicaudatus OX=10030 GN=HSPB1 PE=1 SV=1
5	Q00649	1.29e-92	270	193	0.634	0.674	HSPB1_CHICK Heat shock protein beta-1 OS=Gallus gallus OX=9031 GN=HSPB1 PE=2 SV=1
6	A4VAK4	4.01e-84	249	199	0.595	0.613	A4VAK4_DANRE Heat shock protein beta-1 OS=Danio rerio OX=7955 GN=hsp1 PE=1 SV=1
7	P23927	2.11e-35	124	175	0.371	0.434	CRYAB_MOUSE Alpha-crystallin B chain OS=Mus musculus OX=10090 GN=Cryab PE=1 SV=2
8	P23928	2.57e-35	124	175	0.371	0.434	CRYAB_RAT Alpha-crystallin B chain OS=Rattus norvegicus OX=10116 GN=Cryab PE=1 SV=1
9	P02510	8.89e-35	123	175	0.376	0.440	CRYAB_BOVIN Alpha-crystallin B chain OS=Bos taurus OX=9913 GN=CRYAB PE=1 SV=2
10	P02511	1.01e-34	123	175	0.376	0.440	CRYAB_HUMAN Alpha-crystallin B chain OS=Homo sapiens OX=9606 GN=CRYAB PE=1 SV=2
11	V9HW27	1.01e-34	123	175	0.376	0.440	V9HW27_HUMAN Alpha-crystallin B chain OS=Homo sapiens OX=9606 GN=HEL-S-101 PE=1 SV=1
12	Q6DG35	3.19e-32	116	165	0.268	0.333	Q6DG35_DANRE Alpha-crystallin B chain OS=Danio rerio OX=7955 GN=cryab2 PE=1 SV=1
13	P02489	5.11e-32	115	173	0.341	0.405	CRYAA_HUMAN Alpha-crystallin A chain OS=Homo sapiens OX=9606 GN=CRYAA PE=1 SV=2
14	Q8UUZ6	2.86e-31	114	173	0.332	0.393	Q8UUZ6_DANRE Alpha A crystallin OS=Danio rerio OX=7955 GN=wu:fc06h04 PE=1 SV=1
15	P02470	4.13e-31	113	173	0.337	0.399	CRYAA_BOVIN Alpha-crystallin A chain OS=Bos taurus OX=9913 GN=CRYAA PE=1 SV=1
16	Q9JK92	8.89e-30	110	196	0.337	0.352	HSPB8_MOUSE Heat shock protein beta-8 OS=Mus musculus OX=10090 GN=Hspb8 PE=1 SV=1
17	Q9UJY1	1.67e-29	110	196	0.351	0.367	HSPB8_HUMAN Heat shock protein beta-8 OS=Homo sapiens OX=9606 GN=HSPB8 PE=1 SV=1
18	Q9PUR2	4.77e-29	108	168	0.244	0.298	Q9PUR2_DANRE Alpha b crystallin OS=Danio rerio OX=7955 GN=cryab PE=1 SV=1
19	P82147	8.04e-29	108	187	0.327	0.358	L2EFL_DROME Protein lethal(2)essential for life OS=Drosophila melanogaster OX=7227 GN=l(2)efl PE=1 SV=1
20	P24623	4.53e-28	106	196	0.322	0.337	CRYAA_RAT Alpha-crystallin A chain OS=Rattus norvegicus OX=10116 GN=Cryaa PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00011 HSP20	3.1e-22	90.0	Hsp20/alpha crystallin family
2	PF07873 YabP	2.2e+02	13.0	YabP family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000248553

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356070	0.998	MAP kinase-activated protein kinase 2
2	9606.ENSP00000363668	0.996	Death domain-associated protein 6
3	9606.ENSP00000451828	0.995	RAC-alpha serine/threonine-protein kinase
4	9606.ENSP00000307786	0.993	Cytochrome c
5	9606.ENSP00000449381	0.992	MAP kinase-activated protein kinase 5
6	9606.ENSP00000229795	0.985	Mitogen-activated protein kinase 14
7	9606.ENSP00000396467	0.981	MAP kinase-activated protein kinase 3
8	9606.ENSP00000432083	0.972	Heat shock cognate 71 kDa protein
9	9606.ENSP00000335153	0.966	Heat shock protein HSP 90-alpha
10	9606.ENSP00000364802	0.964	Heat shock 70 kDa protein 1A
11	9606.ENSP00000269305	0.962	Cellular tumor antigen p53
12	9606.ENSP00000333685	0.958	Mitogen-activated protein kinase 11
13	9606.ENSP00000378332	0.958	Transforming growth factor beta-1-induced transcript 1 protein
14	9606.ENSP00000405330	0.958	Estrogen receptor
15	9606.ENSP00000313199	0.952	Heterogeneous nuclear ribonucleoprotein D0
16	9606.ENSP00000304697	0.945	Polyubiquitin-B
17	9606.ENSP00000302961	0.944	Heat shock protein family A member 4
18	9606.ENSP00000416255	0.941	Eukaryotic translation initiation factor 4 gamma 1
19	9606.ENSP00000347979	0.924	Tumor necrosis factor receptor superfamily member 6
20	9606.ENSP00000356694	0.923	Tumor necrosis factor ligand superfamily member 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.956	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0048523	0.995	negative regulation of cellular process
GO:0009987	0.994	cellular process
GO:0006950	0.987	response to stress
GO:0043067	0.975	regulation of programmed cell death
GO:0060548	0.970	negative regulation of cell death
GO:0042981	0.947	regulation of apoptotic process
GO:0043069	0.941	negative regulation of programmed cell death
GO:0019222	0.933	regulation of metabolic process
GO:0043066	0.927	negative regulation of apoptotic process
GO:0042221	0.919	response to chemical
GO:0051128	0.882	regulation of cellular component organization
GO:0065008	0.871	regulation of biological quality
GO:0048518	0.868	positive regulation of biological process
GO:0060255	0.868	regulation of macromolecule metabolic process
GO:0080090	0.862	regulation of primary metabolic process
GO:0051239	0.852	regulation of multicellular organismal process
GO:0051171	0.851	regulation of nitrogen compound metabolic process
GO:0009628	0.847	response to abiotic stimulus
GO:0051716	0.832	cellular response to stimulus
GO:0009893	0.809	positive regulation of metabolic process
GO:0048522	0.790	positive regulation of cellular process
GO:0010604	0.788	positive regulation of macromolecule metabolic process
GO:0031323	0.773	regulation of cellular metabolic process
GO:0071840	0.771	cellular component organization or biogenesis
GO:0016043	0.760	cellular component organization
GO:0048583	0.759	regulation of response to stimulus
GO:0007154	0.669	cell communication
GO:0051129	0.632	negative regulation of cellular component organization
GO:0023052	0.630	signaling
GO:0051246	0.621	regulation of protein metabolic process
GO:0032501	0.616	multicellular organismal process
GO:0010033	0.597	response to organic substance
GO:0010468	0.590	regulation of gene expression
GO:0065009	0.579	regulation of molecular function
GO:0010646	0.562	regulation of cell communication
GO:0023051	0.553	regulation of signaling
GO:0010605	0.547	negative regulation of macromolecule metabolic process
GO:0009408	0.537	response to heat
GO:0070887	0.535	cellular response to chemical stimulus
GO:0009966	0.531	regulation of signal transduction
GO:0007165	0.516	signal transduction
GO:0008152	0.485	metabolic process
GO:0051172	0.483	negative regulation of nitrogen compound metabolic process
GO:0051173	0.463	positive regulation of nitrogen compound metabolic process
GO:0031325	0.446	positive regulation of cellular metabolic process
GO:0050790	0.436	regulation of catalytic activity
GO:0009719	0.423	response to endogenous stimulus
GO:0009889	0.422	regulation of biosynthetic process
GO:0080134	0.421	regulation of response to stress
GO:0071704	0.411	organic substance metabolic process
GO:0010556	0.395	regulation of macromolecule biosynthetic process
GO:0031326	0.392	regulation of cellular biosynthetic process
GO:0033554	0.391	cellular response to stress
GO:0044237	0.390	cellular metabolic process
GO:0019219	0.373	regulation of nucleobase-containing compound metabolic process
GO:0019220	0.368	regulation of phosphate metabolic process
GO:0031399	0.360	regulation of protein modification process
GO:0042325	0.357	regulation of phosphorylation
GO:0048584	0.351	positive regulation of response to stimulus
GO:1902531	0.331	regulation of intracellular signal transduction
GO:0032502	0.319	developmental process
GO:0051252	0.316	regulation of RNA metabolic process
GO:0031324	0.313	negative regulation of cellular metabolic process
GO:0051247	0.309	positive regulation of protein metabolic process
GO:0007166	0.305	cell surface receptor signaling pathway
GO:0035556	0.302	intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.999	nucleus
GO:0005829	0.967	cytosol
GO:0043232	0.930	intracellular non-membrane-bounded organelle
GO:0016020	0.885	membrane
GO:0070013	0.697	intracellular organelle lumen
GO:0071944	0.654	cell periphery
GO:0005886	0.643	plasma membrane
GO:0031982	0.541	vesicle
GO:0005576	0.512	extracellular region
GO:0070062	0.390	extracellular exosome
GO:0032991	0.340	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]