StarFunc result for job id P04808

User Input

>input (185 residues)
MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQE
DAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALK
DSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRS
LAKYC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04808	1.000	1.000	8.589E-31	185	1.000	1.000	P04808.pdb.gz	REL1_HUMAN Prorelaxin H1 OS=Homo sapiens OX=9606 GN=RLN1 PE=1 SV=1
2	AFDB:P04090	0.573	0.573	4.058E-22	185	0.822	0.822	P04090.pdb.gz	REL2_HUMAN Prorelaxin H2 OS=Homo sapiens OX=9606 GN=RLN2 PE=1 SV=1
3	AFDB:P01347	0.413	0.411	1.123E-13	186	0.514	0.511	P01347.pdb.gz	REL1_RAT Prorelaxin 1 OS=Rattus norvegicus OX=10116 GN=Rln1 PE=1 SV=1
4	AFDB:P01348	0.273	0.277	2.594E-12	182	0.541	0.549	P01348.pdb.gz	RELX_PIG Prorelaxin OS=Sus scrofa OX=9823 GN=RLN PE=1 SV=1
5	AFDB:P47932	0.400	0.400	6.848E-11	185	0.492	0.492	P47932.pdb.gz	REL1_MOUSE Prorelaxin 1 OS=Mus musculus OX=10090 GN=Rln1 PE=1 SV=1
6	AFDB:Q9QY05	0.256	0.249	6.691E-6	191	0.281	0.272	Q9QY05.pdb.gz	INSL6_MOUSE Insulin-like peptide INSL6 OS=Mus musculus OX=10090 GN=Insl6 PE=2 SV=1
7	AFDB:B1AC67	0.209	0.202	6.933E-5	192	0.211	0.203	B1AC67.pdb.gz	B1AC67_CHICK Relaxin 3 OS=Gallus gallus OX=9031 GN=RFLB PE=2 SV=1
8	AFDB:Q9Y5Q6	0.335	0.433	3.222E-4	135	0.189	0.259	Q9Y5Q6.pdb.gz	INSL5_HUMAN Insulin-like peptide INSL5 OS=Homo sapiens OX=9606 GN=INSL5 PE=1 SV=2
9	AFDB:Q8WXF3	0.279	0.351	2.236E-3	142	0.200	0.261	Q8WXF3.pdb.gz	REL3_HUMAN Relaxin-3 OS=Homo sapiens OX=9606 GN=RLN3 PE=1 SV=1
10	PDB:2w0cT	0.091	0.124	2.876	127	0.081	0.118	2w0cT.pdb.gz	Insights Into Virus Evolution and Membrane Biogenesis from the Structure of the Marine Lipid-Containing Bacteriophage Pm2
11	PDB:7emfN	0.107	0.028	4.017	1017	0.130	0.024	7emfN.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
12	PDB:7r5jV0	0.118	0.085	4.294	273	0.157	0.106	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
13	AFDB:C4R5T1	0.131	0.077	4.850	384	0.103	0.049	C4R5T1.pdb.gz	ATG30_KOMPG Autophagy-related protein 30 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG30 PE=1 SV=1
14	PDB:5nrlG	0.138	0.075	6.412	372	0.108	0.054	5nrlG.pdb.gz	Structure of a pre-catalytic spliceosome.
15	PDB:7luvB	0.123	0.120	8.375	189	0.146	0.143	7luvB.pdb.gz
16	PDB:5datSM	0.119	0.137	9.572	159	0.124	0.145	5datSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
17	PDB:7peqAJ	0.135	0.038	9.572	996	0.135	0.025	7peqAJ.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P04808	5.13e-136	379	185	1.000	1.000	REL1_HUMAN Prorelaxin H1 OS=Homo sapiens OX=9606 GN=RLN1 PE=1 SV=1
2	P04090	1.81e-110	314	185	0.822	0.822	REL2_HUMAN Prorelaxin H2 OS=Homo sapiens OX=9606 GN=RLN2 PE=1 SV=1
3	P01348	9.44e-60	186	182	0.546	0.555	RELX_PIG Prorelaxin OS=Sus scrofa OX=9823 GN=RLN PE=1 SV=1
4	P01347	9.95e-50	160	186	0.459	0.457	REL1_RAT Prorelaxin 1 OS=Rattus norvegicus OX=10116 GN=Rln1 PE=1 SV=1
5	P47932	1.02e-45	150	185	0.438	0.438	REL1_MOUSE Prorelaxin 1 OS=Mus musculus OX=10090 GN=Rln1 PE=1 SV=1
6	Q9QY05	7.81e-10	57.8	191	0.243	0.236	INSL6_MOUSE Insulin-like peptide INSL6 OS=Mus musculus OX=10090 GN=Insl6 PE=2 SV=1
7	Q14641	5.33e-06	46.2	139	0.205	0.273	INSL4_HUMAN Early placenta insulin-like peptide OS=Homo sapiens OX=9606 GN=INSL4 PE=1 SV=1
8	B1AC67	9.16e-05	43.5	192	0.227	0.219	B1AC67_CHICK Relaxin 3 OS=Gallus gallus OX=9031 GN=RFLB PE=2 SV=1
9	Q8WXF3	0.067	34.7	142	0.092	0.120	REL3_HUMAN Relaxin-3 OS=Homo sapiens OX=9606 GN=RLN3 PE=1 SV=1
10	Q8BFS3	0.082	34.7	140	0.076	0.100	REL3_RAT Relaxin-3 OS=Rattus norvegicus OX=10116 GN=Rln3 PE=2 SV=1
11	Q8CHK2	0.17	33.5	141	0.070	0.092	REL3_MOUSE Relaxin-3 OS=Mus musculus OX=10090 GN=Rln3 PE=2 SV=1
12	Q9WUK0	0.31	32.7	128	0.211	0.305	INSL3_RAT Insulin-like 3 OS=Rattus norvegicus OX=10116 GN=Insl3 PE=2 SV=2
13	Q9Y5Q6	0.44	32.3	135	0.119	0.163	INSL5_HUMAN Insulin-like peptide INSL5 OS=Homo sapiens OX=9606 GN=INSL5 PE=1 SV=2
14	Q9WUG6	0.57	32.0	135	0.216	0.296	INSL5_MOUSE Insulin-like peptide INSL5 OS=Mus musculus OX=10090 GN=Insl5 PE=2 SV=1
15	Q91ZU6	0.66	33.1	7393	0.200	0.005	DYST_MOUSE Dystonin OS=Mus musculus OX=10090 GN=Dst PE=1 SV=2
16	O09107	1.7	30.4	122	0.184	0.279	INSL3_MOUSE Insulin-like 3 OS=Mus musculus OX=10090 GN=Insl3 PE=1 SV=2
17	D5IGG0	2.8	30.8	378	0.097	0.048	CARAA_SPHSX Carbazole 1,9a-dioxygenase, terminal oxygenase component CarAa OS=Sphingomonas sp. OX=28214 GN=carAa PE=1 SV=1
18	P51460	2.8	30.0	131	0.059	0.084	INSL3_HUMAN Insulin-like 3 OS=Homo sapiens OX=9606 GN=INSL3 PE=1 SV=2
19	P20437	3.2	30.8	546	0.135	0.046	CG11_YEAST G1/S-specific cyclin CLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CLN1 PE=1 SV=2
20	F4JAY0	6.9	30.0	2199	0.173	0.015	F4JAY0_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g06530 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00049 Insulin	2.2e-18	78.3	Insulin/IGF/Relaxin family
2	PF03488 Ins_beta	2.3e+02	13.2	Nematode insulin-related peptide beta type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000223862

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298386	0.992	Relaxin receptor 2
2	9606.ENSP00000405841	0.990	Relaxin receptor 1
3	9606.ENSP00000397415	0.966	Relaxin-3
4	9606.ENSP00000302724	0.963	Insulin-like peptide INSL5
5	9606.ENSP00000369017	0.952	Insulin-like 3
6	9606.ENSP00000328708	0.899	Relaxin-3 receptor 1
7	9606.ENSP00000357301	0.879	Relaxin-3 receptor 2
8	9606.ENSP00000371040	0.846	Prorelaxin H2
9	9606.ENSP00000239316	0.764	Early placenta insulin-like peptide
10	9606.ENSP00000356247	0.720	Leucine-rich repeat-containing G-protein coupled receptor 6
11	9606.ENSP00000380432	0.539	Insulin
12	9606.ENSP00000223864	0.517	Plasminogen receptor (KT)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005179	1.000	hormone activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0048518	0.990	positive regulation of biological process
GO:0022414	0.962	reproductive process
GO:0051239	0.953	regulation of multicellular organismal process
GO:0050794	0.947	regulation of cellular process
GO:0032501	0.930	multicellular organismal process
GO:0009987	0.839	cellular process
GO:0044706	0.822	multi-multicellular organism process
GO:0032502	0.787	developmental process
GO:0048522	0.778	positive regulation of cellular process
GO:0044703	0.709	multi-organism reproductive process
GO:0050793	0.704	regulation of developmental process
GO:0051240	0.528	positive regulation of multicellular organismal process
GO:0019222	0.519	regulation of metabolic process
GO:0060255	0.510	regulation of macromolecule metabolic process
GO:0010604	0.468	positive regulation of macromolecule metabolic process
GO:0010468	0.457	regulation of gene expression
GO:0023052	0.447	signaling
GO:0007154	0.447	cell communication
GO:1901342	0.423	regulation of vasculature development
GO:0051094	0.412	positive regulation of developmental process
GO:0050896	0.404	response to stimulus
GO:0010628	0.403	positive regulation of gene expression
GO:0048583	0.363	regulation of response to stimulus
GO:0065009	0.347	regulation of molecular function
GO:0051716	0.308	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0016020	0.479	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]