StarFunc result for job id P05019

User Input

>input (195 residues)
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRR
EIGSRNAECRGKKGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05019	1.000	1.000	1.423E-33	195	1.000	1.000	P05019.pdb.gz	IGF1_HUMAN Insulin-like growth factor I OS=Homo sapiens OX=9606 GN=IGF1 PE=1 SV=1
2	AFDB:F2X2F3	0.397	0.440	1.252E-19	172	0.733	0.831	F2X2F3.pdb.gz	F2X2F3_BOVIN Insulin-like growth factor I OS=Bos taurus OX=9913 GN=IGF1 PE=2 SV=1
3	AFDB:F2X2F0	0.364	0.449	3.650E-18	154	0.677	0.857	F2X2F0.pdb.gz	F2X2F0_BOVIN Insulin-like growth factor I OS=Bos taurus OX=9913 GN=IGF-I PE=2 SV=1
4	AFDB:C5J073	0.309	0.385	2.090E-16	153	0.590	0.752	C5J073.pdb.gz	C5J073_CHICK Insulin-like growth factor OS=Gallus gallus OX=9031 GN=IGF-I PE=2 SV=1
5	AFDB:P16501	0.339	0.418	3.552E-15	153	0.533	0.680	P16501.pdb.gz	IGF1A_XENLA Insulin-like growth factor I-A OS=Xenopus laevis OX=8355 GN=igf1-a PE=2 SV=2
6	AFDB:A4GUE7	0.364	0.399	6.973E-15	176	0.482	0.534	A4GUE7.pdb.gz	A4GUE7_SALSA Insulin-like growth factor I OS=Salmo salar OX=8030 GN=LOC106609475 PE=2 SV=1
7	AFDB:Q90VV9	0.352	0.419	1.676E-14	161	0.441	0.534	Q90VV9.pdb.gz	Q90VV9_DANRE Insulin-like growth factor 1 OS=Danio rerio OX=7955 GN=IGF-1 PE=2 SV=1
8	AFDB:Q6V293	0.329	0.398	8.886E-12	159	0.431	0.528	Q6V293.pdb.gz	Q6V293_ICTPU Insulin-like growth factor I OS=Ictalurus punctatus OX=7998 GN=igf1 PE=2 SV=1
9	AFDB:A4GUE9	0.318	0.292	6.601E-9	214	0.344	0.313	A4GUE9.pdb.gz	A4GUE9_SALSA Insulin-like growth factor II OS=Salmo salar OX=8030 GN=LOC100136550 PE=2 SV=1
10	AFDB:P33717	0.306	0.319	7.486E-8	187	0.313	0.326	P33717.pdb.gz	IGF2_CHICK Insulin-like growth factor II OS=Gallus gallus OX=9031 GN=IGF2 PE=1 SV=2
11	PDB:2kqpA	0.223	0.477	2.835E-3	86	0.154	0.349	2kqpA.pdb.gz
12	PDB:6v7wE	0.106	0.093	7.093	234	0.031	0.026	6v7wE.pdb.gz	A phage-encoded anti-activator inhibits quorum sensing in Pseudomonas aeruginosa.
13	PDB:6mrjB	0.109	0.141	8.118	142	0.067	0.092	6mrjB.pdb.gz	Crystal structure of H.pylori NikR in complex with DNA
14	PDB:6cbqA	0.077	0.066	8.684	234	0.026	0.021	6cbqA.pdb.gz	Mechanism of agonism and antagonism of the Pseudomonas aeruginosa quorum sensing regulator QscR with non-native ligands.
15	PDB:1sceC	0.103	0.149	9.290	111	0.082	0.144	1sceC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05019	8.40e-146	404	195	1.000	1.000	IGF1_HUMAN Insulin-like growth factor I OS=Homo sapiens OX=9606 GN=IGF1 PE=1 SV=1
2	F2X2F1	6.02e-121	342	188	0.872	0.904	F2X2F1_BOVIN Insulin-like growth factor I OS=Bos taurus OX=9913 GN=IGF1 PE=2 SV=1
3	F2X2F3	4.86e-106	303	172	0.764	0.866	F2X2F3_BOVIN Insulin-like growth factor I OS=Bos taurus OX=9913 GN=IGF1 PE=2 SV=1
4	Q5U743	1.04e-97	281	153	0.687	0.876	Q5U743_HUMAN Insulin-like growth factor I OS=Homo sapiens OX=9606 GN=IGF1 PE=2 SV=1
5	Q13429	1.36e-95	275	139	0.677	0.950	Q13429_HUMAN Insulin-like growth factor I (Fragment) OS=Homo sapiens OX=9606 GN=IGF-I PE=2 SV=1
6	P16545	9.20e-95	274	153	0.667	0.850	IGF1_PIG Insulin-like growth factor I OS=Sus scrofa OX=9823 GN=IGF1 PE=2 SV=1
7	Q45QB4	9.20e-95	274	153	0.667	0.850	Q45QB4_PIG Insulin-like growth factor I OS=Sus scrofa OX=9823 GN=IGFI PE=2 SV=1
8	Q0PPT3	5.93e-94	272	153	0.662	0.843	Q0PPT3_PIG Insulin-like growth factor I OS=Sus scrofa OX=9823 GN=IGFI PE=2 SV=1
9	P08025	2.63e-91	265	153	0.641	0.817	IGF1_RAT Insulin-like growth factor I OS=Rattus norvegicus OX=10116 GN=Igf1 PE=1 SV=3
10	F2X2F0	4.60e-91	265	154	0.662	0.838	F2X2F0_BOVIN Insulin-like growth factor I OS=Bos taurus OX=9913 GN=IGF-I PE=2 SV=1
11	P07455	4.60e-91	265	154	0.662	0.838	IGF1_BOVIN Insulin-like growth factor I OS=Bos taurus OX=9913 GN=IGF1 PE=1 SV=2
12	P05017	3.49e-90	262	153	0.631	0.804	IGF1_MOUSE Insulin-like growth factor I OS=Mus musculus OX=10090 GN=Igf1 PE=1 SV=2
13	M1T4V2	9.96e-82	241	153	0.585	0.745	M1T4V2_CHICK Insulin-like growth factor I OS=Gallus gallus OX=9031 GN=IGF-1 PE=2 SV=1
14	C5J073	1.14e-81	241	153	0.585	0.745	C5J073_CHICK Insulin-like growth factor OS=Gallus gallus OX=9031 GN=IGF-I PE=2 SV=1
15	P18254	1.14e-81	241	153	0.585	0.745	IGF1_CHICK Insulin-like growth factor I OS=Gallus gallus OX=9031 GN=IGF1 PE=1 SV=1
16	H6U4T4	8.14e-80	236	153	0.590	0.752	H6U4T4_CHICK Insulin-like growth factor I OS=Gallus gallus OX=9031 GN=IGF-1 PE=3 SV=1
17	G8HMZ1	1.01e-79	236	153	0.574	0.732	G8HMZ1_CHICK Insulin-like growth factor 1 OS=Gallus gallus OX=9031 GN=IGF-1 PE=3 SV=1
18	Q9NP10	2.13e-79	234	130	0.569	0.854	Q9NP10_HUMAN Insulin-like growth factor I OS=Homo sapiens OX=9606 GN=IGF1 PE=1 SV=1
19	G8HMZ3	2.50e-77	230	153	0.574	0.732	G8HMZ3_CHICK Insulin-like growth factor 1 OS=Gallus gallus OX=9031 GN=IGF-1 PE=3 SV=1
20	G8HMZ4	3.47e-77	229	153	0.559	0.712	G8HMZ4_CHICK Insulin-like growth factor 1 OS=Gallus gallus OX=9031 GN=IGF-1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11064 DUF2865	62	15.4	Protein of unknown function (DUF2865)
2	PF00049 Insulin	2.7e-10	52.4	Insulin/IGF/Relaxin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302665

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233813	0.999	Insulin-like growth factor-binding protein 5
2	9606.ENSP00000268035	0.999	Insulin-like growth factor 1 receptor
3	9606.ENSP00000269593	0.999	Insulin-like growth factor-binding protein 4
4	9606.ENSP00000275525	0.999	Insulin-like growth factor-binding protein 1
5	9606.ENSP00000303830	0.999	Insulin receptor
6	9606.ENSP00000370473	0.999	Insulin-like growth factor-binding protein 3
7	9606.ENSP00000380432	0.998	Insulin
8	9606.ENSP00000405330	0.998	Estrogen receptor
9	9606.ENSP00000233809	0.997	Insulin-like growth factor-binding protein 2
10	9606.ENSP00000304895	0.997	Insulin receptor substrate 1
11	9606.ENSP00000381793	0.994	Growth factor receptor-bound protein 10
12	9606.ENSP00000431418	0.994	High affinity nerve growth factor receptor
13	9606.ENSP00000376345	0.993	Growth factor receptor-bound protein 2
14	9606.ENSP00000303394	0.989	Heat shock protein beta-3
15	9606.ENSP00000365016	0.986	Insulin receptor substrate 2
16	9606.ENSP00000416683	0.985	Insulin-like growth factor-binding protein complex acid labile subunit
17	9606.ENSP00000052754	0.983	Decorin
18	9606.ENSP00000349437	0.982	Cation-independent mannose-6-phosphate receptor
19	9606.ENSP00000346839	0.978	Fibronectin type III domain containing
20	9606.ENSP00000264498	0.976	Fibroblast growth factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005159	1.000	insulin-like growth factor receptor binding
GO:0005158	1.000	insulin receptor binding
GO:0005178	1.000	integrin binding
GO:0005179	0.995	hormone activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0048518	0.986	positive regulation of biological process
GO:0009725	0.985	response to hormone
GO:0048522	0.984	positive regulation of cellular process
GO:0009651	0.981	response to salt stress
GO:0051602	0.980	response to electrical stimulus
GO:0006972	0.980	hyperosmotic response
GO:0060416	0.979	response to growth hormone
GO:0051051	0.977	negative regulation of transport
GO:0009893	0.975	positive regulation of metabolic process
GO:2000649	0.972	regulation of sodium ion transmembrane transporter activity
GO:0034766	0.969	negative regulation of monoatomic ion transmembrane transport
GO:0032780	0.968	negative regulation of ATP-dependent activity
GO:1901018	0.967	positive regulation of potassium ion transmembrane transporter activity
GO:0042538	0.960	hyperosmotic salinity response
GO:0032410	0.960	negative regulation of transporter activity
GO:0051171	0.958	regulation of nitrogen compound metabolic process
GO:1902307	0.958	positive regulation of sodium ion transmembrane transport
GO:0043267	0.954	negative regulation of potassium ion transport
GO:1904063	0.940	negative regulation of cation transmembrane transport
GO:0032413	0.939	negative regulation of ion transmembrane transporter activity
GO:0071704	0.931	organic substance metabolic process
GO:1903406	0.927	regulation of P-type sodium:potassium-exchanging transporter activity
GO:2000651	0.927	positive regulation of sodium ion transmembrane transporter activity
GO:0009991	0.925	response to extracellular stimulus
GO:0060255	0.922	regulation of macromolecule metabolic process
GO:0080090	0.921	regulation of primary metabolic process
GO:0031667	0.912	response to nutrient levels
GO:0032868	0.912	response to insulin
GO:0048583	0.908	regulation of response to stimulus
GO:0051246	0.894	regulation of protein metabolic process
GO:0065008	0.889	regulation of biological quality
GO:0032781	0.873	positive regulation of ATP-dependent activity
GO:0010604	0.873	positive regulation of macromolecule metabolic process
GO:0031325	0.856	positive regulation of cellular metabolic process
GO:0051173	0.852	positive regulation of nitrogen compound metabolic process
GO:0023051	0.849	regulation of signaling
GO:0010646	0.849	regulation of cell communication
GO:0051247	0.842	positive regulation of protein metabolic process
GO:0051716	0.834	cellular response to stimulus
GO:0050793	0.833	regulation of developmental process
GO:0007154	0.810	cell communication
GO:0009966	0.810	regulation of signal transduction
GO:0032502	0.777	developmental process
GO:0008283	0.773	cell population proliferation
GO:0048856	0.766	anatomical structure development
GO:0048584	0.765	positive regulation of response to stimulus
GO:0032094	0.765	response to food
GO:0009967	0.759	positive regulation of signal transduction
GO:1902531	0.752	regulation of intracellular signal transduction
GO:0023052	0.745	signaling
GO:0007165	0.740	signal transduction
GO:0008284	0.725	positive regulation of cell population proliferation
GO:0031326	0.700	regulation of cellular biosynthetic process
GO:0051239	0.697	regulation of multicellular organismal process
GO:0010556	0.696	regulation of macromolecule biosynthetic process
GO:0032501	0.676	multicellular organismal process
GO:0070887	0.669	cellular response to chemical stimulus
GO:0071495	0.658	cellular response to endogenous stimulus
GO:0051094	0.648	positive regulation of developmental process
GO:0051240	0.645	positive regulation of multicellular organismal process
GO:0071310	0.643	cellular response to organic substance
GO:0019220	0.609	regulation of phosphate metabolic process
GO:0042325	0.603	regulation of phosphorylation
GO:0045937	0.600	positive regulation of phosphate metabolic process
GO:0031399	0.594	regulation of protein modification process
GO:1901701	0.591	cellular response to oxygen-containing compound
GO:0044238	0.574	primary metabolic process
GO:0001932	0.555	regulation of protein phosphorylation
GO:0044237	0.545	cellular metabolic process
GO:1901653	0.518	cellular response to peptide
GO:0006807	0.514	nitrogen compound metabolic process
GO:0010468	0.514	regulation of gene expression
GO:0019219	0.488	regulation of nucleobase-containing compound metabolic process
GO:0007166	0.483	cell surface receptor signaling pathway
GO:0007275	0.448	multicellular organism development
GO:0031401	0.426	positive regulation of protein modification process
GO:0050790	0.421	regulation of catalytic activity
GO:0043170	0.411	macromolecule metabolic process
GO:0009892	0.411	negative regulation of metabolic process
GO:0042981	0.395	regulation of apoptotic process
GO:2000145	0.392	regulation of cell motility
GO:2000112	0.387	regulation of cellular macromolecule biosynthetic process
GO:0045935	0.384	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.380	positive regulation of cellular biosynthetic process
GO:0051252	0.373	regulation of RNA metabolic process
GO:0010605	0.365	negative regulation of macromolecule metabolic process
GO:0048731	0.356	system development
GO:0051128	0.355	regulation of cellular component organization
GO:2001141	0.355	regulation of RNA biosynthetic process
GO:0010557	0.354	positive regulation of macromolecule biosynthetic process
GO:1901564	0.351	organonitrogen compound metabolic process
GO:0048585	0.346	negative regulation of response to stimulus
GO:0006355	0.343	regulation of DNA-templated transcription
GO:0045893	0.303	positive regulation of DNA-templated transcription
GO:0060341	0.301	regulation of cellular localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005622	0.892	intracellular anatomical structure
GO:0043227	0.879	membrane-bounded organelle
GO:0005737	0.873	cytoplasm
GO:0043231	0.865	intracellular membrane-bounded organelle
GO:0016020	0.715	membrane
GO:0070013	0.671	intracellular organelle lumen
GO:0071944	0.649	cell periphery
GO:0012505	0.590	endomembrane system
GO:0031982	0.562	vesicle
GO:0005886	0.440	plasma membrane
GO:0031410	0.438	cytoplasmic vesicle
GO:0031981	0.342	nuclear lumen
GO:0032991	0.333	protein-containing complex
GO:0005654	0.317	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]