StarFunc result for job id P05023

User Input

>input (1023 residues)
MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLS
RGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAA
TEEEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSI
NAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETR
NIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAV
FLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKN
LEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLA
LSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEI
PFNSTNKYQLSIHKNPNTSEPQHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQN
AYLELGGLGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPIDNLCFVGLISMIDPPRAAVP
DAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDA
KACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVN
DSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTL
TSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPK
TDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVDWDDRWINDVED
SYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFE
ETALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKE
TYY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3b8eA	0.936	0.959	0.000	998	0.957	0.981	3b8eA.pdb.gz	Crystal structure of the sodium-potassium pump.
2	PDB:7x20A	0.929	0.963	0.000	986	0.642	0.666	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
3	PDB:8d3xA	0.941	0.973	0.000	989	0.850	0.880	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
4	AFDB:A2VDL6	0.976	0.979	0.000	1020	0.871	0.874	A2VDL6.pdb.gz	AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus OX=9913 GN=ATP1A2 PE=1 SV=1
5	AFDB:A8QI34	0.962	0.975	0.000	1009	0.611	0.619	A8QI34.pdb.gz	A8QI34_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=JYalpha PE=3 SV=2
6	AFDB:B0S5Q5	0.978	0.984	0.000	1017	0.848	0.853	B0S5Q5.pdb.gz
7	AFDB:B8JKS9	0.992	0.992	0.000	1023	0.794	0.794	B8JKS9.pdb.gz
8	AFDB:C0H8U1	0.982	0.977	0.000	1028	0.864	0.860	C0H8U1.pdb.gz	C0H8U1_SALSA Sodium/potassium-transporting ATPase subunit alpha OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
9	AFDB:E1B8N5	0.979	0.973	0.000	1030	0.799	0.793	E1B8N5.pdb.gz	E1B8N5_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A4 PE=3 SV=2
10	AFDB:P13607	0.969	0.953	0.000	1041	0.747	0.734	P13607.pdb.gz	ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=Atpalpha PE=1 SV=3
11	AFDB:P20648	0.978	0.967	0.000	1035	0.630	0.622	P20648.pdb.gz	ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens OX=9606 GN=ATP4A PE=1 SV=5
12	AFDB:P54707	0.970	0.955	0.000	1039	0.643	0.633	P54707.pdb.gz	AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens OX=9606 GN=ATP12A PE=1 SV=3
13	AFDB:P54708	0.971	0.959	0.000	1036	0.647	0.639	P54708.pdb.gz	AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus OX=10116 GN=Atp12a PE=1 SV=1
14	PDB:3ixzA	0.921	0.943	1.875E-97	998	0.616	0.631	3ixzA.pdb.gz
15	PDB:7e7sA	0.586	0.588	7.653E-56	1020	0.269	0.270	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
16	PDB:5zmwA	0.570	0.581	1.105E-52	1000	0.274	0.280	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
17	PDB:6a69A	0.549	0.604	5.670E-39	911	0.229	0.257	6a69A.pdb.gz
18	PDB:7vpkA	0.691	0.672	2.934E-35	1055	0.184	0.178	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
19	PDB:7vh5A	0.502	0.617	3.932E-34	804	0.195	0.248	7vh5A.pdb.gz
20	PDB:7kycA	0.630	0.556	7.727E-33	1178	0.189	0.164	7kycA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A060D574	1607	875	0.759	0.887	A0A060D574_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=NAKa1c PE=2 SV=1
2	A0A060D9G1	1529	876	0.707	0.825	A0A060D9G1_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=NAKa1a PE=2 SV=1
3	A0A060XA63	971	517	0.448	0.886	A0A060XA63_ONCMY Sodium/potassium-transporting ATPase subunit alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00000245001 PE=3 SV=1
4	A0A060YJC3	1839	992	0.857	0.884	A0A060YJC3_ONCMY Sodium/potassium-transporting ATPase subunit alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00025817001 PE=3 SV=1
5	A0A060YK73	989	534	0.457	0.875	A0A060YK73_ONCMY Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00025818001 PE=3 SV=1
6	A0A075Q735	1087	639	0.523	0.837	A0A075Q735_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=ATP1A1 PE=2 SV=1
7	A0A075QE41	1125	661	0.542	0.838	A0A075QE41_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=ATP1A1 PE=2 SV=1
8	A2VDL6	1848	1020	0.871	0.874	AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus OX=9913 GN=ATP1A2 PE=1 SV=1
9	A8QI34	1295	1009	0.612	0.620	A8QI34_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=JYalpha PE=3 SV=2
10	C0H8U1	1810	1028	0.864	0.860	C0H8U1_SALSA Sodium/potassium-transporting ATPase subunit alpha OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
11	C0PUF8	1008	524	0.464	0.906	C0PUF8_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
12	E1B8N5	1672	1030	0.788	0.783	E1B8N5_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A4 PE=3 SV=2
13	F1MR06	1746	988	0.827	0.856	F1MR06_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A3 PE=3 SV=3
14	P05023	2118	1023	1.000	1.000	AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1
15	P05024	2078	1021	0.981	0.983	AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa OX=9823 GN=ATP1A1 PE=1 SV=1
16	P06685	2060	1023	0.968	0.968	AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Atp1a1 PE=1 SV=1
17	P06686	1838	1020	0.866	0.869	AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Atp1a2 PE=1 SV=1
18	P06687	1839	1013	0.854	0.863	AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Atp1a3 PE=1 SV=2
19	P09572	1947	1021	0.925	0.927	AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus OX=9031 GN=ATP1A1 PE=2 SV=1
20	P09626	1358	1033	0.620	0.614	ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus OX=10116 GN=Atp4a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	1.1e-19	81.6	Cation transport ATPase (P-type)
2	PF00689 Cation_ATPase_C	8.2e-41	151.2	Cation transporting ATPase, C-terminus
3	PF00690 Cation_ATPase_N	1.8e-13	61.3	Cation transporter/ATPase, N-terminus
4	PF00122 E1-E2_ATPase	2.1e-41	153.0	E1-E2 ATPase
5	PF00702 Hydrolase	1.6e-15	69.6	haloacid dehalogenase-like hydrolase
6	PF08282 Hydrolase_3	0.031	25.6	haloacid dehalogenase-like hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000006216

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000018167	0.999	Sodium/potassium-transporting ATPase subunit beta
2	61853.ENSNLEP00000013433	0.982	FXYD domain containing ion transport regulator 1
3	61853.ENSNLEP00000011836	0.980	Sodium/potassium-transporting ATPase subunit beta
4	61853.ENSNLEP00000018196	0.947	Sodium/potassium-transporting ATPase subunit beta
5	61853.ENSNLEP00000016268	0.931	ATPase, Na+/K+ transporting, alpha 3 polypeptide
6	61853.ENSNLEP00000011791	0.912	Retinoschisin 1
7	61853.ENSNLEP00000005650	0.894	Sodium/potassium-transporting ATPase subunit beta
8	61853.ENSNLEP00000001002	0.841	ATPase, H+/K+ exchanging, beta polypeptide
9	61853.ENSNLEP00000006237	0.836	Sterile alpha motif domain containing 7
10	61853.ENSNLEP00000000288	0.819	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
11	61853.ENSNLEP00000008963	0.800	FXYD domain-containing ion transport regulator
12	61853.ENSNLEP00000015079	0.778	Opsin 1 (cone pigments), short-wave-sensitive
13	61853.ENSNLEP00000003277	0.774	Calcium-transporting ATPase
14	61853.ENSNLEP00000011539	0.759	Sodium/hydrogen exchanger
15	61853.ENSNLEP00000016383	0.741	Cardiac phospholamban
16	61853.ENSNLEP00000020354	0.708	ATP-binding cassette, sub-family G (WHITE), member 5
17	61853.ENSNLEP00000020371	0.708	ATP-binding cassette, sub-family G (WHITE), member 8
18	61853.ENSNLEP00000016331	0.684	ATPase, Na+/K+ transporting, alpha 4 polypeptide
19	61853.ENSNLEP00000022830	0.670	FXYD domain containing ion transport regulator 4
20	61853.ENSNLEP00000009103	0.658	Potassium inwardly-rectifying channel, subfamily J, member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005391	0.999	P-type sodium:potassium-exchanging transporter activity
GO:0005515	0.997	protein binding
GO:0097159	0.543	organic cyclic compound binding
GO:1901363	0.321	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.972	regulation of biological process
GO:0051179	0.966	localization
GO:0032501	0.966	multicellular organismal process
GO:0009987	0.965	cellular process
GO:0006810	0.951	transport
GO:0050896	0.950	response to stimulus
GO:0006814	0.927	sodium ion transport
GO:0098660	0.926	inorganic ion transmembrane transport
GO:0044057	0.915	regulation of system process
GO:0042391	0.900	regulation of membrane potential
GO:0034220	0.897	monoatomic ion transmembrane transport
GO:0021591	0.879	ventricular system development
GO:1903522	0.872	regulation of blood circulation
GO:0008016	0.856	regulation of heart contraction
GO:0050794	0.851	regulation of cellular process
GO:0098662	0.851	inorganic cation transmembrane transport
GO:0098657	0.841	import into cell
GO:0098655	0.828	monoatomic cation transmembrane transport
GO:0006873	0.825	intracellular monoatomic ion homeostasis
GO:0030003	0.815	intracellular monoatomic cation homeostasis
GO:0098771	0.814	inorganic ion homeostasis
GO:0003012	0.792	muscle system process
GO:0006813	0.789	potassium ion transport
GO:0098739	0.772	import across plasma membrane
GO:0035725	0.772	sodium ion transmembrane transport
GO:0008015	0.761	blood circulation
GO:0090257	0.755	regulation of muscle system process
GO:0006937	0.750	regulation of muscle contraction
GO:0060047	0.747	heart contraction
GO:0098659	0.744	inorganic cation import across plasma membrane
GO:0006942	0.724	regulation of striated muscle contraction
GO:0140115	0.697	export across plasma membrane
GO:0055078	0.688	sodium ion homeostasis
GO:0042221	0.687	response to chemical
GO:0009719	0.676	response to endogenous stimulus
GO:1901700	0.647	response to oxygen-containing compound
GO:0071805	0.643	potassium ion transmembrane transport
GO:0007154	0.641	cell communication
GO:0055075	0.636	potassium ion homeostasis
GO:0007626	0.590	locomotory behavior
GO:0006950	0.588	response to stress
GO:0010033	0.583	response to organic substance
GO:0051716	0.553	cellular response to stimulus
GO:0043434	0.548	response to peptide hormone
GO:0009628	0.407	response to abiotic stimulus
GO:0023052	0.306	signaling
GO:0048518	0.303	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.989	membrane-bounded organelle
GO:0005622	0.975	intracellular anatomical structure
GO:0032991	0.966	protein-containing complex
GO:0098796	0.953	membrane protein complex
GO:1902495	0.940	transmembrane transporter complex
GO:0005737	0.927	cytoplasm
GO:0043231	0.911	intracellular membrane-bounded organelle
GO:0031982	0.899	vesicle
GO:0098590	0.858	plasma membrane region
GO:0012505	0.838	endomembrane system
GO:0098797	0.833	plasma membrane protein complex
GO:0098533	0.816	ATPase dependent transmembrane transport complex
GO:0090533	0.782	cation-transporting ATPase complex
GO:0005890	0.763	sodium:potassium-exchanging ATPase complex
GO:0005576	0.756	extracellular region
GO:0031090	0.694	organelle membrane
GO:1903561	0.681	extracellular vesicle
GO:0042383	0.671	sarcolemma
GO:0005615	0.620	extracellular space
GO:0070062	0.573	extracellular exosome
GO:0030054	0.368	cell junction
GO:0005634	0.358	nucleus
GO:0045178	0.342	basal part of cell
GO:0042995	0.322	cell projection
GO:0120025	0.307	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18353	0.999	ATP + H2O + K(+)(out) + Na(+)(in) = ADP + H(+) + K(+)(in) + Na(+)(out) + phosphate
EC:7.2.2.13	0.999	Na(+)/K(+)-exchanging ATPase.

[back to server]