StarFunc result for job id P05026

User Input

>input (303 residues)
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLT
ISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD
MIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKL
NRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPL
QYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIE
VKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07340	0.996	0.993	6.610E-63	304	0.947	0.944	P07340.pdb.gz	AT1B1_RAT Sodium/potassium-transporting ATPase subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Atp1b1 PE=1 SV=1
2	AFDB:P08251	0.986	0.980	1.865E-54	305	0.713	0.708	P08251.pdb.gz	AT1B1_CHICK Sodium/potassium-transporting ATPase subunit beta-1 OS=Gallus gallus OX=9031 GN=ATP1B1 PE=1 SV=1
3	AFDB:Q91580	0.968	0.965	8.254E-52	304	0.660	0.658	Q91580.pdb.gz	Q91580_XENLA Sodium/potassium-transporting ATPase subunit beta OS=Xenopus laevis OX=8355 GN=atp1b1.S PE=2 SV=1
4	PDB:7x20B	0.876	0.920	2.586E-51	288	0.898	0.944	7x20B.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
5	PDB:3wguB	0.952	0.952	1.777E-50	303	0.924	0.924	3wguB.pdb.gz	Crystal structure of a Na1-bound Na1,K1-ATPase preceding the E1P state
6	AFDB:Q6NYH5	0.932	0.924	1.430E-47	306	0.571	0.565	Q6NYH5.pdb.gz	Q6NYH5_DANRE Sodium/potassium-transporting ATPase subunit beta OS=Danio rerio OX=7955 GN=fj91b11 PE=1 SV=1
7	AFDB:Q5PNP7	0.754	0.898	5.469E-36	253	0.396	0.474	Q5PNP7.pdb.gz
8	AFDB:Q9UN42	0.822	0.702	1.773E-33	357	0.323	0.275	Q9UN42.pdb.gz	AT1B4_HUMAN Protein ATP1B4 OS=Homo sapiens OX=9606 GN=ATP1B4 PE=1 SV=1
9	AFDB:P13638	0.845	0.882	2.137E-33	290	0.370	0.386	P13638.pdb.gz	AT1B2_RAT Sodium/potassium-transporting ATPase subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Atp1b2 PE=1 SV=1
10	AFDB:Q90Z34	0.823	0.853	5.429E-33	292	0.386	0.401	Q90Z34.pdb.gz	Q90Z34_DANRE Sodium/potassium-transporting ATPase subunit beta OS=Danio rerio OX=7955 GN=cb712 PE=1 SV=1
11	AFDB:Q99ME6	0.817	0.700	3.505E-32	356	0.317	0.270	Q99ME6.pdb.gz	AT1B4_MOUSE Protein ATP1B4 OS=Mus musculus OX=10090 GN=Atp1b4 PE=1 SV=1
12	AFDB:P54709	0.808	0.875	2.408E-31	279	0.347	0.376	P54709.pdb.gz	AT1B3_HUMAN Sodium/potassium-transporting ATPase subunit beta-3 OS=Homo sapiens OX=9606 GN=ATP1B3 PE=1 SV=1
13	PDB:6jxkB	0.759	0.843	1.677E-26	271	0.300	0.336	6jxkB.pdb.gz	A single K + -binding site in the crystal structure of the gastric proton pump.
14	PDB:2xzbB	0.506	0.863	9.242E-12	175	0.211	0.366	2xzbB.pdb.gz
15	PDB:7sqcO1	0.185	0.096	3.337E-2	673	0.023	0.010	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:4x8gA	0.186	0.103	3.779E-2	606	0.056	0.028	4x8gA.pdb.gz	Inhibition of PAD4 activity is sufficient to disrupt mouse and human NET formation.
17	PDB:5dcaA	0.174	0.037	4.021E-2	1948	0.050	0.008	5dcaA.pdb.gz
18	PDB:4aq1A	0.209	0.100	5.487E-2	721	0.036	0.015	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
19	PDB:4b0mM	0.215	0.288	5.839E-2	212	0.053	0.075	4b0mM.pdb.gz
20	PDB:7d56C	0.189	0.098	7.036E-2	640	0.040	0.019	7d56C.pdb.gz	Structures of human peptidylarginine deiminase type III provide insights into substrate recognition and inhibitor design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05026	0.0	621	303	1.000	1.000	AT1B1_HUMAN Sodium/potassium-transporting ATPase subunit beta-1 OS=Homo sapiens OX=9606 GN=ATP1B1 PE=1 SV=1
2	P05027	0.0	581	303	0.924	0.924	AT1B1_PIG Sodium/potassium-transporting ATPase subunit beta-1 OS=Sus scrofa OX=9823 GN=ATP1B1 PE=1 SV=2
3	P07340	0.0	593	304	0.950	0.947	AT1B1_RAT Sodium/potassium-transporting ATPase subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Atp1b1 PE=1 SV=1
4	P14094	0.0	590	304	0.941	0.938	AT1B1_MOUSE Sodium/potassium-transporting ATPase subunit beta-1 OS=Mus musculus OX=10090 GN=Atp1b1 PE=1 SV=1
5	Q9TT37	0.0	577	303	0.914	0.914	AT1B1_RABIT Sodium/potassium-transporting ATPase subunit beta-1 OS=Oryctolagus cuniculus OX=9986 GN=ATP1B1 PE=1 SV=1
6	P08251	3.93e-167	468	305	0.713	0.708	AT1B1_CHICK Sodium/potassium-transporting ATPase subunit beta-1 OS=Gallus gallus OX=9031 GN=ATP1B1 PE=1 SV=1
7	Q91580	2.55e-150	425	304	0.660	0.658	Q91580_XENLA Sodium/potassium-transporting ATPase subunit beta OS=Xenopus laevis OX=8355 GN=atp1b1.S PE=2 SV=1
8	Q6NYH5	5.11e-129	371	306	0.574	0.569	Q6NYH5_DANRE Sodium/potassium-transporting ATPase subunit beta OS=Danio rerio OX=7955 GN=fj91b11 PE=1 SV=1
9	P14415	2.69e-67	213	290	0.389	0.407	AT1B2_HUMAN Sodium/potassium-transporting ATPase subunit beta-2 OS=Homo sapiens OX=9606 GN=ATP1B2 PE=1 SV=3
10	P14231	4.48e-65	207	290	0.386	0.403	AT1B2_MOUSE Sodium/potassium-transporting ATPase subunit beta-2 OS=Mus musculus OX=10090 GN=Atp1b2 PE=1 SV=2
11	P13638	1.11e-64	207	290	0.380	0.397	AT1B2_RAT Sodium/potassium-transporting ATPase subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Atp1b2 PE=1 SV=1
12	Q90Z34	2.30e-63	203	292	0.399	0.414	Q90Z34_DANRE Sodium/potassium-transporting ATPase subunit beta OS=Danio rerio OX=7955 GN=cb712 PE=1 SV=1
13	Q9UN42	3.07e-53	179	357	0.343	0.291	AT1B4_HUMAN Protein ATP1B4 OS=Homo sapiens OX=9606 GN=ATP1B4 PE=1 SV=1
14	P54709	5.28e-52	174	279	0.356	0.387	AT1B3_HUMAN Sodium/potassium-transporting ATPase subunit beta-3 OS=Homo sapiens OX=9606 GN=ATP1B3 PE=1 SV=1
15	Q9R193	7.34e-50	171	356	0.330	0.281	AT1B4_RAT Protein ATP1B4 OS=Rattus norvegicus OX=10116 GN=Atp1b4 PE=1 SV=1
16	Q9BDK6	2.33e-49	169	355	0.333	0.285	AT1B4_PIG Protein ATP1B4 OS=Sus scrofa OX=9823 GN=ATP1B4 PE=1 SV=1
17	Q99ME6	3.78e-49	169	356	0.330	0.281	AT1B4_MOUSE Protein ATP1B4 OS=Mus musculus OX=10090 GN=Atp1b4 PE=1 SV=1
18	P18597	6.63e-46	158	291	0.314	0.326	ATP4B_RABIT Potassium-transporting ATPase subunit beta OS=Oryctolagus cuniculus OX=9986 GN=ATP4B PE=1 SV=1
19	P18598	3.51e-45	157	294	0.297	0.306	ATP4B_RAT Potassium-transporting ATPase subunit beta OS=Rattus norvegicus OX=10116 GN=Atp4b PE=2 SV=3
20	P97370	5.92e-45	155	278	0.323	0.353	AT1B3_MOUSE Sodium/potassium-transporting ATPase subunit beta-3 OS=Mus musculus OX=10090 GN=Atp1b3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00287 Na_K-ATPase	1e-98	341.7	Sodium / potassium ATPase beta chain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356790

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000445306	0.999	Sodium/potassium-transporting ATPase subunit alpha-1
2	9606.ENSP00000444688	0.989	Sodium/potassium-transporting ATPase subunit alpha-3
3	9606.ENSP00000354490	0.987	Sodium/potassium-transporting ATPase subunit alpha-2
4	9606.ENSP00000292079	0.981	Sodium/potassium-transporting ATPase subunit gamma
5	9606.ENSP00000357060	0.979	Sodium/potassium-transporting ATPase subunit alpha-4
6	9606.ENSP00000218548	0.926	Potassium-transporting ATPase alpha chain 2
7	9606.ENSP00000270310	0.912	FXYD domain containing ion transport regulator 7
8	9606.ENSP00000481244	0.907	Phospholemman
9	9606.ENSP00000440045	0.904	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
10	9606.ENSP00000250111	0.893	Sodium/potassium-transporting ATPase subunit beta-2
11	9606.ENSP00000362841	0.878	Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1
12	9606.ENSP00000286371	0.825	Sodium/potassium-transporting ATPase subunit beta-3
13	9606.ENSP00000218008	0.820	Protein ATP1B4
14	9606.ENSP00000263980	0.809	Sodium/hydrogen exchanger 1
15	9606.ENSP00000226760	0.799	Wolframin
16	9606.ENSP00000359340	0.788	Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4
17	9606.ENSP00000262623	0.744	Potassium-transporting ATPase alpha chain 1
18	9606.ENSP00000356785	0.744	Nucleoside diphosphate kinase 7
19	9606.ENSP00000344155	0.740	ATP-binding cassette sub-family A member 2
20	9606.ENSP00000393316	0.731	Thioredoxin-related transmembrane protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.999	enzyme binding
GO:0060590	0.996	ATPase regulator activity
GO:0001671	0.994	ATPase activator activity
GO:0051117	0.993	ATPase binding
GO:0005215	0.901	transporter activity
GO:0022857	0.894	transmembrane transporter activity
GO:0060090	0.835	molecular adaptor activity
GO:0030674	0.734	protein-macromolecule adaptor activity
GO:0015318	0.717	inorganic molecular entity transmembrane transporter activity
GO:0015075	0.699	monoatomic ion transmembrane transporter activity
GO:1901702	0.642	salt transmembrane transporter activity
GO:0022890	0.620	inorganic cation transmembrane transporter activity
GO:0008324	0.598	monoatomic cation transmembrane transporter activity
GO:0046873	0.574	metal ion transmembrane transporter activity
GO:0022804	0.555	active transmembrane transporter activity
GO:0042626	0.417	ATPase-coupled transmembrane transporter activity
GO:0022853	0.405	active monoatomic ion transmembrane transporter activity
GO:0015081	0.355	sodium ion transmembrane transporter activity
GO:0046982	0.332	protein heterodimerization activity
GO:0015079	0.320	potassium ion transmembrane transporter activity
GO:0019829	0.320	ATPase-coupled monoatomic cation transmembrane transporter activity
GO:0015662	0.314	P-type ion transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0065008	0.996	regulation of biological quality
GO:0140115	0.995	export across plasma membrane
GO:0035725	0.995	sodium ion transmembrane transport
GO:1901379	0.992	regulation of potassium ion transmembrane transport
GO:1904064	0.991	positive regulation of cation transmembrane transport
GO:0019725	0.986	cellular homeostasis
GO:0098771	0.986	inorganic ion homeostasis
GO:0050801	0.986	monoatomic ion homeostasis
GO:0032781	0.986	positive regulation of ATP-dependent activity
GO:0043268	0.985	positive regulation of potassium ion transport
GO:0032414	0.985	positive regulation of ion transmembrane transporter activity
GO:1901016	0.982	regulation of potassium ion transmembrane transporter activity
GO:1901381	0.982	positive regulation of potassium ion transmembrane transport
GO:0030003	0.977	intracellular monoatomic cation homeostasis
GO:1902307	0.975	positive regulation of sodium ion transmembrane transport
GO:1901018	0.974	positive regulation of potassium ion transmembrane transporter activity
GO:0006813	0.964	potassium ion transport
GO:0042391	0.956	regulation of membrane potential
GO:0098739	0.939	import across plasma membrane
GO:2000649	0.923	regulation of sodium ion transmembrane transporter activity
GO:0055075	0.897	potassium ion homeostasis
GO:0099587	0.888	inorganic ion import across plasma membrane
GO:2000651	0.887	positive regulation of sodium ion transmembrane transporter activity
GO:0008016	0.885	regulation of heart contraction
GO:1903406	0.871	regulation of P-type sodium:potassium-exchanging transporter activity
GO:0050896	0.829	response to stimulus
GO:0098659	0.822	inorganic cation import across plasma membrane
GO:0071805	0.822	potassium ion transmembrane transport
GO:0050821	0.769	protein stabilization
GO:0055078	0.713	sodium ion homeostasis
GO:0007154	0.588	cell communication
GO:0032501	0.572	multicellular organismal process
GO:0051716	0.473	cellular response to stimulus
GO:0008152	0.466	metabolic process
GO:0071704	0.412	organic substance metabolic process
GO:0044237	0.378	cellular metabolic process
GO:0044238	0.361	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902495	0.997	transmembrane transporter complex
GO:0098797	0.995	plasma membrane protein complex
GO:0005890	0.991	sodium:potassium-exchanging ATPase complex
GO:0043227	0.837	membrane-bounded organelle
GO:0005622	0.763	intracellular anatomical structure
GO:0043231	0.684	intracellular membrane-bounded organelle
GO:0005737	0.645	cytoplasm
GO:0098590	0.564	plasma membrane region
GO:0016324	0.505	apical plasma membrane
GO:0065010	0.320	extracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.423	Translocases.
RHEA:34963	0.355	Na(+)(in) = Na(+)(out)
RHEA:29463	0.320	K(+)(in) = K(+)(out)

[back to server]