StarFunc result for job id P05067

User Input

>input (770 residues)
MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTK
TCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVG
EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR
GVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE
EADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPC
RAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARD
PVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA
KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL
QAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYER
MNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTET
KTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTN
IKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05067	1.000	1.000	0.000	770	1.000	1.000	P05067.pdb.gz	A4_HUMAN Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3
2	AFDB:B0V0E5	0.308	0.316	4.337E-83	751	0.657	0.674	B0V0E5.pdb.gz	B0V0E5_DANRE Amyloid-beta A4 protein OS=Danio rerio OX=7955 GN=appb PE=1 SV=1
3	AFDB:A0A0R4IN41	0.277	0.289	2.394E-81	738	0.662	0.691	A0A0R4IN41.pdb.gz
4	AFDB:P15943	0.294	0.296	1.797E-70	765	0.491	0.494	P15943.pdb.gz	APLP2_RAT Amyloid beta precursor like protein 2 OS=Rattus norvegicus OX=10116 GN=Aplp2 PE=1 SV=2
5	AFDB:A0A0R4IZ16	0.322	0.358	4.277E-70	682	0.599	0.676	A0A0R4IZ16.pdb.gz
6	AFDB:B0V0E4	0.325	0.358	5.609E-70	694	0.599	0.664	B0V0E4.pdb.gz
7	AFDB:Q06335	0.325	0.350	4.110E-56	707	0.435	0.474	Q06335.pdb.gz	APLP2_MOUSE Amyloid beta precursor like protein 2 OS=Mus musculus OX=10090 GN=Aplp2 PE=1 SV=4
8	AFDB:Q03157	0.262	0.308	8.886E-44	653	0.330	0.389	Q03157.pdb.gz	APLP1_MOUSE Amyloid beta precursor like protein 1 OS=Mus musculus OX=10090 GN=Aplp1 PE=1 SV=2
9	AFDB:P51693	0.268	0.314	6.969E-43	650	0.318	0.377	P51693.pdb.gz	APLP1_HUMAN Amyloid beta precursor like protein 1 OS=Homo sapiens OX=9606 GN=APLP1 PE=1 SV=3
10	AFDB:Q4ZHV6	0.289	0.278	3.296E-33	804	0.269	0.257	Q4ZHV6.pdb.gz	Q4ZHV6_MANSE Beta amyloid protein-like protein OS=Manduca sexta OX=7130 PE=1 SV=3
11	PDB:3bybA	0.069	0.891	4.610E-5	58	0.032	0.431	3bybA.pdb.gz
12	PDB:4bd9B	0.067	0.311	6.737E-5	165	0.032	0.152	4bd9B.pdb.gz	A Noncanonical Mechanism of Carboxypeptidase Inhibition Revealed by the Crystal Structure of the Tri-Kunitz Smci in Complex with Human Cpa4.
13	PDB:2m01A	0.069	0.757	5.435E-3	59	0.029	0.373	2m01A.pdb.gz
14	PDB:3n5fA	0.051	0.088	9.365E-1	406	0.012	0.022	3n5fA.pdb.gz	Mutational and structural analysis of L-N-carbamoylase reveals new insights into a peptidase m20/m25/m40 family member.
15	PDB:5mkkA	0.072	0.089	1.102	593	0.036	0.047	5mkkA.pdb.gz
16	PDB:3pcoB	0.075	0.074	1.228	795	0.027	0.026	3pcoB.pdb.gz	Idiosyncrasy and identity in the prokaryotic phe-system: crystal structure of E. coli phenylalanyl-tRNA synthetase complexed with phenylalanine and AMP.
17	PDB:6s9wA	0.059	0.089	1.525	411	0.022	0.041	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
18	PDB:4n78F	0.075	0.269	1.795	156	0.021	0.103	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
19	PDB:5yfgA	0.050	0.146	1.795	186	0.019	0.081	5yfgA.pdb.gz
20	PDB:7o9mf	0.055	0.227	2.000	130	0.008	0.046	7o9mf.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0V0E5	0.0	1010	751	0.656	0.672	B0V0E5_DANRE Amyloid-beta A4 protein OS=Danio rerio OX=7955 GN=appb PE=1 SV=1
2	P05067	0.0	1610	770	1.000	1.000	A4_HUMAN Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3
3	P08592	0.0	1557	770	0.969	0.969	A4_RAT Amyloid-beta precursor protein OS=Rattus norvegicus OX=10116 GN=App PE=1 SV=2
4	P12023	0.0	1551	770	0.966	0.966	A4_MOUSE Amyloid-beta precursor protein OS=Mus musculus OX=10090 GN=App PE=1 SV=3
5	P15943	0.0	703	765	0.497	0.501	APLP2_RAT Amyloid beta precursor like protein 2 OS=Rattus norvegicus OX=10116 GN=Aplp2 PE=1 SV=2
6	Q06335	0.0	578	707	0.449	0.489	APLP2_MOUSE Amyloid beta precursor like protein 2 OS=Mus musculus OX=10090 GN=Aplp2 PE=1 SV=4
7	Q06481	0.0	712	763	0.509	0.514	APLP2_HUMAN Amyloid beta precursor like protein 2 OS=Homo sapiens OX=9606 GN=APLP2 PE=1 SV=2
8	Q08E54	0.0	592	695	0.357	0.396	Q08E54_BOVIN Amyloid-beta A4 protein OS=Bos taurus OX=9913 GN=APP PE=2 SV=1
9	Q6NUZ1	0.0	1022	738	0.691	0.721	Q6NUZ1_DANRE Amyloid-beta A4 protein OS=Danio rerio OX=7955 GN=wu:fj08a12 PE=2 SV=1
10	Q8UUR9	0.0	560	694	0.369	0.409	Q8UUR9_DANRE Amyloid-beta A4 protein OS=Danio rerio OX=7955 GN=zgc:92771 PE=2 SV=1
11	F5GZ08	3.27e-74	254	611	0.199	0.250	F5GZ08_HUMAN Amyloid beta precursor like protein 1 OS=Homo sapiens OX=9606 GN=APLP1 PE=1 SV=1
12	P51693	4.20e-74	255	650	0.204	0.242	APLP1_HUMAN Amyloid beta precursor like protein 1 OS=Homo sapiens OX=9606 GN=APLP1 PE=1 SV=3
13	B7Z4G8	4.73e-74	255	644	0.204	0.244	B7Z4G8_HUMAN Amyloid beta precursor like protein 1 OS=Homo sapiens OX=9606 GN=APLP1 PE=1 SV=1
14	A0A8I6AD03	8.34e-69	241	655	0.203	0.238	A0A8I6AD03_RAT Amyloid beta precursor like protein 1 OS=Rattus norvegicus OX=10116 GN=Aplp1 PE=3 SV=1
15	Q03157	2.01e-67	237	654	0.199	0.234	APLP1_MOUSE Amyloid beta precursor like protein 1 OS=Mus musculus OX=10090 GN=Aplp1 PE=1 SV=2
16	B1WBV6	3.57e-67	236	644	0.195	0.233	B1WBV6_RAT Aplp1 protein OS=Rattus norvegicus OX=10116 GN=Aplp1 PE=2 SV=1
17	F1LRS5	6.98e-67	235	636	0.192	0.233	F1LRS5_RAT Amyloid beta precursor like protein 1 OS=Rattus norvegicus OX=10116 GN=Aplp1 PE=3 SV=3
18	S4R3U6	3.54e-55	193	289	0.164	0.436	S4R3U6_HUMAN Amyloid beta precursor like protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=APLP1 PE=1 SV=1
19	O35463	1.67e-44	156	79	0.099	0.962	O35463_CRIGR Amyloid-beta A4 protein (Fragment) OS=Cricetulus griseus OX=10029 GN=beta APP PE=2 SV=1
20	Q4ZHV6	6.49e-36	147	804	0.100	0.096	Q4ZHV6_MANSE Beta amyloid protein-like protein OS=Manduca sexta OX=7130 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10515 APP_amyloid	4.2e-22	89.7	Beta-amyloid precursor protein C-terminus
2	PF12924 APP_Cu_bd	6.5e-23	92.5	Copper-binding of amyloid precursor, CuBD
3	PF12925 APP_E2	9e-70	245.7	E2 domain of amyloid precursor protein
4	PF02177 APP_N	8.7e-41	149.7	Amyloid A4 N-terminal heparin-binding
5	PF03494 Beta-APP	6.2e-20	82.1	Beta-amyloid peptide (beta-APP)
6	PF16436 DUF5033	6.5e+02	11.7	Domain of unknown function (DUF5033)
7	PF17870 Insulin_TMD	3.7e+02	12.6	Insulin receptor trans-membrane segment
8	PF00014 Kunitz_BPTI	4.1e-16	70.3	Kunitz/Bovine pancreatic trypsin inhibitor domain
9	PF09548 Spore_III_AB	9.2e+02	11.4	Stage III sporulation protein AB (spore_III_AB)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284981

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260197	0.999	Sortilin-related receptor
2	9606.ENSP00000265381	0.999	Amyloid-beta A4 precursor protein-binding family A member 1
3	9606.ENSP00000294785	0.999	Nicastrin
4	9606.ENSP00000318585	0.999	Beta-secretase 1
5	9606.ENSP00000326366	0.999	Presenilin-1
6	9606.ENSP00000453293	0.999	Amyloid-beta A4 precursor protein-binding family A member 2
7	9606.ENSP00000477213	0.999	Amyloid-beta A4 precursor protein-binding family B member 1
8	9606.ENSP00000252486	0.998	Apolipoprotein E
9	9606.ENSP00000351990	0.997	NEDD8-activating enzyme E1 regulatory subunit
10	9606.ENSP00000358105	0.997	Gamma-secretase subunit APH-1A
11	9606.ENSP00000296861	0.996	Tumor necrosis factor receptor superfamily member 21
12	9606.ENSP00000340330	0.996	Histone acetyltransferase KAT5
13	9606.ENSP00000468411	0.996	Gamma-secretase subunit PEN-2
14	9606.ENSP00000172229	0.994	Tumor necrosis factor receptor superfamily member 16
15	9606.ENSP00000401303	0.994	SHC-transforming protein 1
16	9606.ENSP00000368752	0.993	Major prion protein
17	9606.ENSP00000243077	0.992	Prolow-density lipoprotein receptor-related protein 1
18	9606.ENSP00000260408	0.992	Disintegrin and metalloproteinase domain-containing protein 10
19	9606.ENSP00000460236	0.990	Spondin-1
20	9606.ENSP00000265986	0.989	Insulin-degrading enzyme

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0098772	0.995	molecular function regulator activity
GO:0005515	0.995	protein binding
GO:0061134	0.992	peptidase regulator activity
GO:0005102	0.991	signaling receptor binding
GO:0140677	0.986	molecular function activator activity
GO:0140678	0.976	molecular function inhibitor activity
GO:0030414	0.968	peptidase inhibitor activity
GO:0043167	0.959	ion binding
GO:0004866	0.958	endopeptidase inhibitor activity
GO:0042802	0.957	identical protein binding
GO:0030545	0.954	signaling receptor regulator activity
GO:0030546	0.941	signaling receptor activator activity
GO:0004867	0.911	serine-type endopeptidase inhibitor activity
GO:0019899	0.893	enzyme binding
GO:0048018	0.850	receptor ligand activity
GO:0046983	0.774	protein dimerization activity
GO:0043168	0.746	anion binding
GO:0001664	0.737	G protein-coupled receptor binding
GO:0042803	0.731	protein homodimerization activity
GO:0097645	0.555	amylin binding
GO:0030549	0.555	acetylcholine receptor activator activity
GO:0033130	0.547	acetylcholine receptor binding
GO:0005158	0.546	insulin receptor binding
GO:0042056	0.546	chemoattractant activity
GO:0051425	0.545	PTB domain binding
GO:0050786	0.544	RAGE receptor binding
GO:1904399	0.544	heparan sulfate binding
GO:0046875	0.543	ephrin receptor binding
GO:0005109	0.543	frizzled binding
GO:0043395	0.543	heparan sulfate proteoglycan binding
GO:0034185	0.539	apolipoprotein binding
GO:0051087	0.504	chaperone binding
GO:0005178	0.495	integrin binding
GO:0046982	0.418	protein heterodimerization activity
GO:0003682	0.402	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0048583	0.978	regulation of response to stimulus
GO:0023051	0.973	regulation of signaling
GO:0010646	0.961	regulation of cell communication
GO:0032501	0.957	multicellular organismal process
GO:0050896	0.955	response to stimulus
GO:0048856	0.950	anatomical structure development
GO:0019222	0.945	regulation of metabolic process
GO:0071704	0.928	organic substance metabolic process
GO:0007275	0.927	multicellular organism development
GO:0048519	0.925	negative regulation of biological process
GO:0009966	0.922	regulation of signal transduction
GO:0050730	0.921	regulation of peptidyl-tyrosine phosphorylation
GO:0044238	0.910	primary metabolic process
GO:0048731	0.882	system development
GO:0016043	0.871	cellular component organization
GO:0048518	0.868	positive regulation of biological process
GO:0007399	0.862	nervous system development
GO:0006807	0.840	nitrogen compound metabolic process
GO:0051338	0.790	regulation of transferase activity
GO:0051239	0.789	regulation of multicellular organismal process
GO:0051716	0.787	cellular response to stimulus
GO:0048522	0.785	positive regulation of cellular process
GO:0065008	0.782	regulation of biological quality
GO:0010468	0.771	regulation of gene expression
GO:0044093	0.769	positive regulation of molecular function
GO:0009653	0.759	anatomical structure morphogenesis
GO:0032879	0.750	regulation of localization
GO:0048523	0.750	negative regulation of cellular process
GO:0051247	0.750	positive regulation of protein metabolic process
GO:0051098	0.749	regulation of binding
GO:0043085	0.742	positive regulation of catalytic activity
GO:0043393	0.741	regulation of protein binding
GO:0009889	0.739	regulation of biosynthetic process
GO:0007417	0.734	central nervous system development
GO:0023052	0.732	signaling
GO:0031401	0.731	positive regulation of protein modification process
GO:0010941	0.727	regulation of cell death
GO:1902533	0.726	positive regulation of intracellular signal transduction
GO:0051128	0.725	regulation of cellular component organization
GO:0031326	0.717	regulation of cellular biosynthetic process
GO:0045937	0.714	positive regulation of phosphate metabolic process
GO:0050793	0.711	regulation of developmental process
GO:0042221	0.701	response to chemical
GO:0051049	0.701	regulation of transport
GO:0006950	0.698	response to stress
GO:0023057	0.697	negative regulation of signaling
GO:0045859	0.690	regulation of protein kinase activity
GO:0048585	0.661	negative regulation of response to stimulus
GO:0071900	0.659	regulation of protein serine/threonine kinase activity
GO:0009892	0.657	negative regulation of metabolic process
GO:0009605	0.654	response to external stimulus
GO:0010556	0.650	regulation of macromolecule biosynthetic process
GO:0030154	0.649	cell differentiation
GO:0070887	0.644	cellular response to chemical stimulus
GO:0043170	0.642	macromolecule metabolic process
GO:0010033	0.641	response to organic substance
GO:0043408	0.641	regulation of MAPK cascade
GO:0071902	0.638	positive regulation of protein serine/threonine kinase activity
GO:0043405	0.637	regulation of MAP kinase activity
GO:0010605	0.635	negative regulation of macromolecule metabolic process
GO:0007154	0.625	cell communication
GO:0043406	0.616	positive regulation of MAP kinase activity
GO:0051172	0.612	negative regulation of nitrogen compound metabolic process
GO:0010469	0.605	regulation of signaling receptor activity
GO:0044237	0.600	cellular metabolic process
GO:0071495	0.595	cellular response to endogenous stimulus
GO:0045595	0.593	regulation of cell differentiation
GO:1901701	0.591	cellular response to oxygen-containing compound
GO:0007610	0.578	behavior
GO:0007165	0.577	signal transduction
GO:0044419	0.566	biological process involved in interspecies interaction between organisms
GO:0061097	0.559	regulation of protein tyrosine kinase activity
GO:0050803	0.552	regulation of synapse structure or activity
GO:0002376	0.549	immune system process
GO:0071310	0.549	cellular response to organic substance
GO:0099177	0.546	regulation of trans-synaptic signaling
GO:0045664	0.543	regulation of neuron differentiation
GO:0051179	0.534	localization
GO:0051707	0.529	response to other organism
GO:0010243	0.514	response to organonitrogen compound
GO:0022008	0.514	neurogenesis
GO:1901564	0.496	organonitrogen compound metabolic process
GO:0003008	0.492	system process
GO:0051240	0.472	positive regulation of multicellular organismal process
GO:0019219	0.469	regulation of nucleobase-containing compound metabolic process
GO:0050890	0.458	cognition
GO:0051252	0.449	regulation of RNA metabolic process
GO:0071417	0.428	cellular response to organonitrogen compound
GO:0009888	0.427	tissue development
GO:1900271	0.419	regulation of long-term synaptic potentiation
GO:0080134	0.418	regulation of response to stress
GO:0007611	0.415	learning or memory
GO:0006952	0.414	defense response
GO:0030030	0.402	cell projection organization
GO:0043067	0.386	regulation of programmed cell death
GO:0042981	0.380	regulation of apoptotic process
GO:0019538	0.379	protein metabolic process
GO:2001141	0.372	regulation of RNA biosynthetic process
GO:0048468	0.365	cell development
GO:0010648	0.363	negative regulation of cell communication
GO:0060429	0.337	epithelium development
GO:0006355	0.328	regulation of DNA-templated transcription
GO:0048729	0.327	tissue morphogenesis
GO:0048699	0.317	generation of neurons
GO:0031324	0.314	negative regulation of cellular metabolic process
GO:0051234	0.312	establishment of localization
GO:0048666	0.305	neuron development
GO:0006810	0.304	transport
GO:0120036	0.304	plasma membrane bounded cell projection organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0012505	0.990	endomembrane system
GO:0031410	0.990	cytoplasmic vesicle
GO:0005576	0.989	extracellular region
GO:0005886	0.989	plasma membrane
GO:0070013	0.988	intracellular organelle lumen
GO:0030054	0.983	cell junction
GO:0042995	0.978	cell projection
GO:0005634	0.978	nucleus
GO:0099503	0.976	secretory vesicle
GO:0032991	0.974	protein-containing complex
GO:0120025	0.970	plasma membrane bounded cell projection
GO:0043005	0.963	neuron projection
GO:0045202	0.946	synapse
GO:0031090	0.932	organelle membrane
GO:0005615	0.918	extracellular space
GO:1903561	0.916	extracellular vesicle
GO:0070062	0.913	extracellular exosome
GO:0005794	0.879	Golgi apparatus
GO:0005783	0.868	endoplasmic reticulum
GO:0009986	0.840	cell surface
GO:0098793	0.760	presynapse
GO:0048471	0.701	perinuclear region of cytoplasm
GO:0005768	0.696	endosome
GO:0030141	0.672	secretory granule
GO:0043232	0.659	intracellular non-membrane-bounded organelle
GO:0005769	0.639	early endosome
GO:0098588	0.575	bounding membrane of organelle
GO:0005829	0.554	cytosol
GO:0005788	0.476	endoplasmic reticulum lumen
GO:0045121	0.457	membrane raft
GO:0031981	0.455	nuclear lumen
GO:0030133	0.438	transport vesicle
GO:0031091	0.431	platelet alpha granule
GO:0060205	0.416	cytoplasmic vesicle lumen
GO:0034774	0.406	secretory granule lumen
GO:0030425	0.387	dendrite
GO:0098794	0.385	postsynapse
GO:0070382	0.384	exocytic vesicle
GO:0070381	0.374	endosome to plasma membrane transport vesicle
GO:0030140	0.371	trans-Golgi network transport vesicle
GO:0034362	0.364	low-density lipoprotein particle
GO:0034363	0.363	intermediate-density lipoprotein particle
GO:0106003	0.362	amyloid-beta complex
GO:0043235	0.359	receptor complex
GO:0005764	0.341	lysosome
GO:0044309	0.337	neuron spine
GO:0043197	0.332	dendritic spine
GO:0005654	0.327	nucleoplasm
GO:0031904	0.324	endosome lumen
GO:0043198	0.323	dendritic shaft
GO:0030424	0.319	axon

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]