StarFunc result for job id P05090

User Input

>input (189 residues)
MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGR
CIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWI
LATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVT
DQVNCPKLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05090	1.000	1.000	4.385E-35	189	1.000	1.000	P05090.pdb.gz	APOD_HUMAN Apolipoprotein D OS=Homo sapiens OX=9606 GN=APOD PE=1 SV=1
2	AFDB:P23593	0.943	0.943	1.793E-29	189	0.714	0.714	P23593.pdb.gz	APOD_RAT Apolipoprotein D OS=Rattus norvegicus OX=10116 GN=Apod PE=1 SV=1
3	AFDB:P51910	0.920	0.920	4.170E-29	189	0.720	0.720	P51910.pdb.gz	APOD_MOUSE Apolipoprotein D OS=Mus musculus OX=10090 GN=Apod PE=1 SV=1
4	PDB:2hzqA	0.843	0.957	3.555E-27	166	0.841	0.958	2hzqA.pdb.gz	Structural insight into the dual ligand specificity and mode of high density lipoprotein association of apolipoprotein d.
5	AFDB:Q8SXR1	0.807	0.687	8.171E-18	224	0.386	0.326	Q8SXR1.pdb.gz	Q8SXR1_DROME Neural lazarillo, isoform A OS=Drosophila melanogaster OX=7227 GN=NLaz PE=1 SV=1
6	AFDB:Q7K024	0.790	0.665	4.197E-14	227	0.280	0.233	Q7K024.pdb.gz	Q7K024_DROME GH09946p (Fragment) OS=Drosophila melanogaster OX=7227 GN=GLaz PE=2 SV=1
7	AFDB:Q8IPX4	0.782	0.770	1.029E-13	192	0.212	0.208	Q8IPX4.pdb.gz	Q8IPX4_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=CG16933 PE=3 SV=1
8	AFDB:P0A901	0.703	0.749	4.053E-13	177	0.280	0.299	P0A901.pdb.gz	BLC_ECOLI Outer membrane lipoprotein Blc OS=Escherichia coli (strain K12) OX=83333 GN=blc PE=1 SV=1
9	AFDB:A7MCJ8	0.700	0.676	3.523E-12	196	0.222	0.214	A7MCJ8.pdb.gz
10	PDB:2acoA	0.696	0.778	3.976E-12	168	0.280	0.315	2acoA.pdb.gz	The membrane bound bacterial lipocalin Blc is a functional dimer with binding preference for lysophospholipids.
11	AFDB:P41263	0.633	0.612	5.096E-12	196	0.270	0.260	P41263.pdb.gz	RET4_CHICK Retinol-binding protein 4 OS=Gallus gallus OX=9031 GN=RBP4 PE=1 SV=1
12	AFDB:Q9FGT8	0.702	0.713	6.293E-12	186	0.286	0.290	Q9FGT8.pdb.gz	TIL_ARATH Temperature-induced lipocalin-1 OS=Arabidopsis thaliana OX=3702 GN=TIL PE=1 SV=1
13	PDB:1femA	0.628	0.669	2.564E-10	176	0.206	0.222	1femA.pdb.gz	Crystallographic studies on complexes between retinoids and plasma retinol-binding protein.
14	PDB:1iiuA	0.670	0.723	3.910E-10	174	0.238	0.259	1iiuA.pdb.gz	Structure of Chicken plasma retinol-binding protein
15	PDB:5n47A	0.705	0.737	2.005E-9	180	0.164	0.172	5n47A.pdb.gz
16	PDB:5n48A	0.709	0.760	3.058E-9	175	0.138	0.149	5n48A.pdb.gz
17	PDB:6z2cA	0.684	0.722	3.398E-9	178	0.159	0.169	6z2cA.pdb.gz	Structure of an engineered lipocalin that catalyzes a Diels-Alder reaction
18	PDB:4iawA	0.687	0.718	3.981E-9	180	0.153	0.161	4iawA.pdb.gz	Structure-guided engineering of Anticalins with improved binding behavior and biochemical characteristics for application in radio-immuno imaging and/or therapy
19	PDB:6gqzA	0.678	0.731	6.746E-9	174	0.159	0.172	6gqzA.pdb.gz
20	PDB:4gh7A	0.673	0.726	9.257E-9	174	0.148	0.161	4gh7A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05090	2.15e-141	393	189	1.000	1.000	APOD_HUMAN Apolipoprotein D OS=Homo sapiens OX=9606 GN=APOD PE=1 SV=1
2	P51910	8.11e-102	293	189	0.720	0.720	APOD_MOUSE Apolipoprotein D OS=Mus musculus OX=10090 GN=Apod PE=1 SV=1
3	P23593	3.00e-96	279	189	0.677	0.677	APOD_RAT Apolipoprotein D OS=Rattus norvegicus OX=10116 GN=Apod PE=1 SV=1
4	Q8SXR1	4.25e-33	119	224	0.365	0.308	Q8SXR1_DROME Neural lazarillo, isoform A OS=Drosophila melanogaster OX=7227 GN=NLaz PE=1 SV=1
5	Q9NAZ4	4.25e-33	119	224	0.365	0.308	Q9NAZ4_DROME Neural Lazarillo OS=Drosophila melanogaster OX=7227 GN=NLaz PE=2 SV=1
6	M9PBN2	7.85e-33	119	245	0.365	0.282	M9PBN2_DROME Neural lazarillo, isoform B OS=Drosophila melanogaster OX=7227 GN=NLaz PE=1 SV=1
7	Q9NAZ3	1.09e-21	89.7	212	0.317	0.283	Q9NAZ3_DROME Glial Lazarillo OS=Drosophila melanogaster OX=7227 GN=GLaz PE=2 SV=1
8	A1Z991	8.19e-21	87.4	212	0.296	0.264	A1Z991_DROME Glial lazarillo, isoform A OS=Drosophila melanogaster OX=7227 GN=GLaz PE=3 SV=1
9	Q7K024	1.41e-20	87.4	227	0.296	0.247	Q7K024_DROME GH09946p (Fragment) OS=Drosophila melanogaster OX=7227 GN=GLaz PE=2 SV=1
10	P0A901	8.46e-17	76.3	177	0.317	0.339	BLC_ECOLI Outer membrane lipoprotein Blc OS=Escherichia coli (strain K12) OX=83333 GN=blc PE=1 SV=1
11	Q9FGT8	3.22e-15	72.0	186	0.291	0.296	TIL_ARATH Temperature-induced lipocalin-1 OS=Arabidopsis thaliana OX=3702 GN=TIL PE=1 SV=1
12	Q9STS7	4.79e-12	65.5	353	0.259	0.139	CHL_ARATH Chloroplastic lipocalin OS=Arabidopsis thaliana OX=3702 GN=CHL PE=1 SV=1
13	Q00724	1.55e-10	59.7	201	0.312	0.294	RET4_MOUSE Retinol-binding protein 4 OS=Mus musculus OX=10090 GN=Rbp4 PE=1 SV=2
14	P04916	1.88e-10	59.7	201	0.312	0.294	RET4_RAT Retinol-binding protein 4 OS=Rattus norvegicus OX=10116 GN=Rbp4 PE=1 SV=1
15	M5AXY1	1.99e-09	57.0	201	0.291	0.274	RET4_FELCA Retinol binding protein 4 OS=Felis catus OX=9685 GN=RBP4 PE=1 SV=1
16	P06912	4.19e-09	55.8	201	0.280	0.264	RET4_RABIT Retinol-binding protein 4 OS=Oryctolagus cuniculus OX=9986 GN=RBP4 PE=1 SV=2
17	P02753	4.72e-09	55.8	201	0.259	0.244	RET4_HUMAN Retinol-binding protein 4 OS=Homo sapiens OX=9606 GN=RBP4 PE=1 SV=3
18	P41263	5.11e-09	55.5	196	0.254	0.245	RET4_CHICK Retinol-binding protein 4 OS=Gallus gallus OX=9031 GN=RBP4 PE=1 SV=1
19	P24774	5.12e-09	55.5	176	0.254	0.273	RET4A_ONCMY Retinol-binding protein 4-A OS=Oncorhynchus mykiss OX=8022 GN=rbp4a PE=1 SV=2
20	Q90Y51	8.71e-09	55.1	192	0.291	0.286	Q90Y51_ONCMY Retinol binding protein 4, plasma OS=Oncorhynchus mykiss OX=8022 GN=RBP PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12904 Collagen_bind_2	2e+02	13.2	Putative collagen-binding domain of a collagenase
2	PF00061 Lipocalin	1e-20	85.8	Lipocalin / cytosolic fatty-acid binding protein family
3	PF08212 Lipocalin_2	7e-23	92.7	Lipocalin-like domain
4	PF01816 LRV	3.7e+02	12.9	Leucine rich repeat variant
5	PF03973 Triabin	0.19	23.1	Triabin
6	PF07137 VDE	0.1	23.7	VDE lipocalin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345179

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356969	0.966	Apolipoprotein A-II
2	9606.ENSP00000477707	0.913	Oxysterols receptor LXR-alpha
3	9606.ENSP00000253727	0.909	Oxysterols receptor LXR-beta
4	9606.ENSP00000419692	0.903	Retinoic acid receptor RXR-alpha
5	9606.ENSP00000363817	0.901	Retinoic acid receptor RXR-beta
6	9606.ENSP00000236850	0.868	Apolipoprotein A-I
7	9606.ENSP00000263598	0.867	Lipocalin-1
8	9606.ENSP00000313833	0.807	Lipocalin-15
9	9606.ENSP00000233242	0.785	Apolipoprotein B-100
10	9606.ENSP00000291568	0.764	Cystatin-B
11	9606.ENSP00000313967	0.759	Complement C1q subcomponent subunit B
12	9606.ENSP00000360696	0.746	Epididymal-specific lipocalin-12
13	9606.ENSP00000441028	0.733	Odorant-binding protein 2a
14	9606.ENSP00000484615	0.733	Odorant-binding protein 2b
15	9606.ENSP00000245185	0.730	Metallothionein-2
16	9606.ENSP00000160827	0.723	Kinesin-like protein KIF22
17	9606.ENSP00000252486	0.703	Apolipoprotein E
18	9606.ENSP00000224181	0.702	Complement component C8 gamma chain
19	9606.ENSP00000277526	0.699	Epididymal-specific lipocalin-9
20	9606.ENSP00000465356	0.692	Apolipoprotein C-I

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015485	1.000	cholesterol binding
GO:0043167	0.944	ion binding
GO:0005102	0.487	signaling receptor binding
GO:0043168	0.435	anion binding
GO:0019840	0.386	isoprenoid binding
GO:0005501	0.348	retinoid binding
GO:0042802	0.340	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0048523	0.978	negative regulation of cellular process
GO:0019222	0.976	regulation of metabolic process
GO:0009892	0.959	negative regulation of metabolic process
GO:0080090	0.952	regulation of primary metabolic process
GO:0060255	0.952	regulation of macromolecule metabolic process
GO:0051171	0.929	regulation of nitrogen compound metabolic process
GO:0042221	0.925	response to chemical
GO:0009987	0.914	cellular process
GO:0006950	0.864	response to stress
GO:0051246	0.804	regulation of protein metabolic process
GO:0010605	0.800	negative regulation of macromolecule metabolic process
GO:0032879	0.782	regulation of localization
GO:0051128	0.777	regulation of cellular component organization
GO:0008152	0.760	metabolic process
GO:0031323	0.758	regulation of cellular metabolic process
GO:0051172	0.750	negative regulation of nitrogen compound metabolic process
GO:0044238	0.748	primary metabolic process
GO:0071704	0.690	organic substance metabolic process
GO:0006979	0.685	response to oxidative stress
GO:0051248	0.655	negative regulation of protein metabolic process
GO:0002682	0.648	regulation of immune system process
GO:0048518	0.621	positive regulation of biological process
GO:0032501	0.587	multicellular organismal process
GO:0051239	0.586	regulation of multicellular organismal process
GO:0044087	0.576	regulation of cellular component biogenesis
GO:2000146	0.569	negative regulation of cell motility
GO:0010810	0.568	regulation of cell-substrate adhesion
GO:0051049	0.563	regulation of transport
GO:0007162	0.536	negative regulation of cell adhesion
GO:0030336	0.532	negative regulation of cell migration
GO:0060341	0.513	regulation of cellular localization
GO:0019216	0.509	regulation of lipid metabolic process
GO:0150116	0.508	regulation of cell-substrate junction organization
GO:0051716	0.483	cellular response to stimulus
GO:1901888	0.483	regulation of cell junction assembly
GO:0032880	0.458	regulation of protein localization
GO:0010812	0.454	negative regulation of cell-substrate adhesion
GO:0002685	0.440	regulation of leukocyte migration
GO:0048522	0.419	positive regulation of cellular process
GO:0010468	0.405	regulation of gene expression
GO:1903828	0.401	negative regulation of protein localization
GO:0051129	0.396	negative regulation of cellular component organization
GO:0045833	0.394	negative regulation of lipid metabolic process
GO:0051241	0.358	negative regulation of multicellular organismal process
GO:0071840	0.331	cellular component organization or biogenesis
GO:0044237	0.322	cellular metabolic process
GO:0006629	0.320	lipid metabolic process
GO:1901700	0.315	response to oxygen-containing compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005615	1.000	extracellular space
GO:0043227	0.999	membrane-bounded organelle
GO:0031982	0.965	vesicle
GO:0043229	0.949	intracellular organelle
GO:0043230	0.945	extracellular organelle
GO:0065010	0.939	extracellular membrane-bounded organelle
GO:0043231	0.939	intracellular membrane-bounded organelle
GO:0070062	0.934	extracellular exosome
GO:0070013	0.720	intracellular organelle lumen
GO:0012505	0.634	endomembrane system
GO:0005829	0.497	cytosol
GO:0005783	0.427	endoplasmic reticulum
GO:0048471	0.363	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]