StarFunc result for job id P05091

User Input

>input (517 residues)
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4fr8C	0.958	0.999	0.000	496	0.954	0.994	4fr8C.pdb.gz	Vascular Bioactivation of Nitroglycerin by Aldehyde Dehydrogenase-2: REACTION INTERMEDIATES REVEALED BY CRYSTALLOGRAPHY AND MASS SPECTROMETRY.
2	AFDB:A0A286XPF7	0.992	0.984	0.000	521	0.952	0.944	A0A286XPF7.pdb.gz	A0A286XPF7_CAVPO Aldehyde dehydrogenase 2 family member OS=Cavia porcellus OX=10141 GN=ALDH2 PE=3 SV=1
3	AFDB:A2BGR9	0.985	0.986	3.789E-102	516	0.778	0.779	A2BGR9.pdb.gz
4	AFDB:Q9CZS1	0.964	0.960	1.791E-97	519	0.729	0.726	Q9CZS1.pdb.gz	AL1B1_MOUSE Aldehyde dehydrogenase X, mitochondrial OS=Mus musculus OX=10090 GN=Aldh1b1 PE=1 SV=1
5	AFDB:Q9VLC5	0.957	0.951	1.543E-95	520	0.702	0.698	Q9VLC5.pdb.gz	Q9VLC5_DROME Aldehyde dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Aldh PE=1 SV=1
6	PDB:1zumI	0.901	0.995	1.784E-95	468	0.903	0.998	1zumI.pdb.gz
7	AFDB:B3DKM0	0.960	0.958	2.430E-91	518	0.656	0.654	B3DKM0.pdb.gz
8	PDB:7mjcA	0.950	0.996	2.977E-91	493	0.714	0.748	7mjcA.pdb.gz	Inhibitors targeted to aldehyde dehydrogenase
9	AFDB:O93344	0.963	0.961	2.460E-90	518	0.646	0.645	O93344.pdb.gz	AL1A2_CHICK Retinal dehydrogenase 2 OS=Gallus gallus OX=9031 GN=ALDH1A2 PE=2 SV=2
10	AFDB:P00352	0.958	0.989	6.580E-90	501	0.660	0.681	P00352.pdb.gz	AL1A1_HUMAN Aldehyde dehydrogenase 1A1 OS=Homo sapiens OX=9606 GN=ALDH1A1 PE=1 SV=2
11	AFDB:O35945	0.961	0.992	7.828E-90	501	0.644	0.665	O35945.pdb.gz	AL1A7_MOUSE Aldehyde dehydrogenase, cytosolic 1 OS=Mus musculus OX=10090 GN=Aldh1a7 PE=1 SV=1
12	AFDB:Q9DD46	0.954	0.963	2.094E-89	512	0.631	0.637	Q9DD46.pdb.gz	Q9DD46_CHICK Aldehyde dehydrogenase OS=Gallus gallus OX=9031 GN=ALDH6 PE=2 SV=1
13	PDB:6aljA	0.948	0.996	4.318E-89	492	0.646	0.679	6aljA.pdb.gz	Structural Basis of ALDH1A2 Inhibition by Irreversible and Reversible Small Molecule Inhibitors.
14	AFDB:P47895	0.956	0.965	7.479E-89	512	0.636	0.643	P47895.pdb.gz	AL1A3_HUMAN Retinaldehyde dehydrogenase 3 OS=Homo sapiens OX=9606 GN=ALDH1A3 PE=1 SV=2
15	PDB:5abmA	0.950	0.995	1.857E-87	494	0.652	0.682	5abmA.pdb.gz	Structural, Biochemical, and Computational Studies Reveal the Mechanism of Selective Aldehyde Dehydrogenase 1A1 Inhibition by Cytotoxic Duocarmycin Analogues.
16	PDB:7yobA	0.950	0.994	5.786E-84	494	0.648	0.678	7yobA.pdb.gz
17	PDB:1o9jA	0.949	0.993	1.864E-82	494	0.632	0.662	1o9jA.pdb.gz	Crystal Structure of Eta-Crystallin: Adaptation of a Class 1 Aldehyde Dehydrogenase for a New Role in the Eye Lens
18	PDB:7a6qA	0.933	0.986	1.058E-81	489	0.627	0.663	7a6qA.pdb.gz	A Selective Competitive Inhibitor of Aldehyde Dehydrogenase 1A3 Hinders Cancer Cell Growth, Invasiveness and Stemness In Vitro.
19	PDB:5fhzF	0.857	0.985	7.973E-72	449	0.582	0.670	5fhzF.pdb.gz	Crystal structure of human aldehyde dehydrogenase 1A3 complexed with NAD(+) and retinoic acid.
20	PDB:7rluA	0.900	0.799	1.970E-68	583	0.441	0.391	7rluA.pdb.gz	Structure of putative tumor suppressor ALDH1L1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A286XPF7	1019	521	0.940	0.933	A0A286XPF7_CAVPO Aldehyde dehydrogenase 2 family member OS=Cavia porcellus OX=10141 GN=ALDH2 PE=3 SV=1
2	A0A384MTJ7	789	517	0.727	0.727	A0A384MTJ7_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
3	C7A2A0	607	534	0.576	0.558	BALDH_ANTMA Benzaldehyde dehydrogenase, mitochondrial OS=Antirrhinum majus OX=4151 GN=BALDH PE=1 SV=1
4	O14293	562	503	0.509	0.523	YF19_SCHPO Putative aldehyde dehydrogenase-like protein C9E9.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9E9.09c PE=1 SV=1
5	O35945	711	501	0.644	0.665	AL1A7_MOUSE Aldehyde dehydrogenase, cytosolic 1 OS=Mus musculus OX=10090 GN=Aldh1a7 PE=1 SV=1
6	O93344	723	518	0.644	0.643	AL1A2_CHICK Retinal dehydrogenase 2 OS=Gallus gallus OX=9031 GN=ALDH1A2 PE=2 SV=2
7	O94788	729	518	0.648	0.647	AL1A2_HUMAN Retinal dehydrogenase 2 OS=Homo sapiens OX=9606 GN=ALDH1A2 PE=1 SV=3
8	P00352	720	501	0.660	0.681	AL1A1_HUMAN Aldehyde dehydrogenase 1A1 OS=Homo sapiens OX=9606 GN=ALDH1A1 PE=1 SV=2
9	P05091	1071	517	1.000	1.000	ALDH2_HUMAN Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2 PE=1 SV=2
10	P08157	565	497	0.551	0.573	ALDH_EMENI Aldehyde dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aldA PE=3 SV=2
11	P11884	1024	519	0.959	0.956	ALDH2_RAT Aldehyde dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aldh2 PE=1 SV=1
12	P13601	699	501	0.634	0.655	AL1A7_RAT Aldehyde dehydrogenase, cytosolic 1 OS=Rattus norvegicus OX=10116 GN=Aldh1a7 PE=1 SV=2
13	P24549	714	501	0.652	0.673	AL1A1_MOUSE Aldehyde dehydrogenase 1A1 OS=Mus musculus OX=10090 GN=Aldh1a1 PE=1 SV=5
14	P30837	789	517	0.727	0.727	AL1B1_HUMAN Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH1B1 PE=1 SV=4
15	P47738	1017	519	0.954	0.950	ALDH2_MOUSE Aldehyde dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh2 PE=1 SV=1
16	P47895	694	512	0.631	0.637	AL1A3_HUMAN Retinaldehyde dehydrogenase 3 OS=Homo sapiens OX=9606 GN=ALDH1A3 PE=1 SV=2
17	P48644	714	501	0.654	0.675	AL1A1_BOVIN Aldehyde dehydrogenase 1A1 OS=Bos taurus OX=9913 GN=ALDH1A1 PE=1 SV=3
18	P51647	713	501	0.652	0.673	AL1A1_RAT Aldehyde dehydrogenase 1A1 OS=Rattus norvegicus OX=10116 GN=Aldh1a1 PE=1 SV=3
19	P51977	716	501	0.656	0.677	AL1A1_SHEEP Aldehyde dehydrogenase 1A1 OS=Ovis aries OX=9940 GN=ALDH1A1 PE=1 SV=2
20	Q28399	692	501	0.634	0.655	ALDH1_ELEED Aldehyde dehydrogenase, cytosolic 1 OS=Elephantulus edwardii OX=28737 GN=ALDH1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00171 Aldedh	2.5e-179	608.3	Aldehyde dehydrogenase family
2	PF06822 DUF1235	2.5e+02	12.4	Protein of unknown function (DUF1235)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261733

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306606	0.992	Alcohol dehydrogenase 1B, beta polypeptide
2	9606.ENSP00000440689	0.974	Cytochrome P450 2E1
3	9606.ENSP00000241052	0.973	Catalase
4	9606.ENSP00000265395	0.971	3-hydroxyisobutyrate dehydrogenase, mitochondrial
5	9606.ENSP00000379845	0.966	4-aminobutyrate aminotransferase, mitochondrial
6	9606.ENSP00000231420	0.964	Alanine--glyoxylate aminotransferase 2, mitochondrial
7	9606.ENSP00000340684	0.961	Amine oxidase [flavin-containing] A
8	9606.ENSP00000450436	0.961	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
9	9606.ENSP00000312326	0.956	Membrane primary amine oxidase
10	9606.ENSP00000265512	0.951	Alcohol dehydrogenase 4, pi polypeptide
11	9606.ENSP00000426083	0.949	Alcohol dehydrogenase 1C, gamma polypeptide
12	9606.ENSP00000316924	0.946	Acetyl-coenzyme A synthetase 2-like, mitochondrial
13	9606.ENSP00000253382	0.944	Acetyl-coenzyme A synthetase, cytoplasmic
14	9606.ENSP00000354511	0.944	Catechol O-methyltransferase
15	9606.ENSP00000361140	0.944	Alcohol dehydrogenase [NADP(+)]
16	9606.ENSP00000253799	0.938	Retina-specific copper amine oxidase
17	9606.ENSP00000367309	0.936	Amine oxidase [flavin-containing] B
18	9606.ENSP00000231887	0.931	Peroxisomal bifunctional enzyme
19	9606.ENSP00000449535	0.930	Acyl-CoA synthetase short-chain family member 3, mitochondrial
20	9606.ENSP00000263182	0.924	Gamma-butyrobetaine dioxygenase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004029	0.998	aldehyde dehydrogenase (NAD+) activity
GO:0005488	0.990	binding
GO:0005515	0.914	protein binding
GO:0042802	0.400	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0009987	0.987	cellular process
GO:0044237	0.980	cellular metabolic process
GO:0044238	0.867	primary metabolic process
GO:0044281	0.830	small molecule metabolic process
GO:0065007	0.588	biological regulation
GO:0050789	0.471	regulation of biological process
GO:0050794	0.423	regulation of cellular process
GO:0006807	0.409	nitrogen compound metabolic process
GO:0009056	0.322	catabolic process
GO:0050896	0.310	response to stimulus
GO:1901575	0.303	organic substance catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005739	0.991	mitochondrion
GO:0070013	0.930	intracellular organelle lumen
GO:0005759	0.520	mitochondrial matrix
GO:0005829	0.340	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16185	0.998	an aldehyde + H2O + NAD(+) = a carboxylate + 2 H(+) + NADH
EC:1.2.1.3	0.998	aldehyde dehydrogenase (NAD(+)).

[back to server]