StarFunc result for job id P05106

User Input

>input (788 residues)
MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRP
DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGT
FECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFG
KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRY
CRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDIL
VVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTF
TNITYRGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1u8cB	0.738	0.965	0.000	599	0.753	0.990	1u8cB.pdb.gz	A novel adaptation of the integrin PSI domain revealed from its crystal structure.
2	PDB:4g1eB	0.839	0.930	0.000	709	0.874	0.972	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
3	AFDB:B3DIP9	0.919	0.917	0.000	790	0.685	0.684	B3DIP9.pdb.gz
4	AFDB:L7RT22	0.725	0.715	0.000	799	0.546	0.538	L7RT22.pdb.gz	L7RT22_HUMAN Integrin beta OS=Homo sapiens OX=9606 GN=ITGB5 PE=1 SV=1
5	AFDB:P05106	1.000	1.000	0.000	788	1.000	1.000	P05106.pdb.gz	ITB3_HUMAN Integrin beta-3 OS=Homo sapiens OX=9606 GN=ITGB3 PE=1 SV=2
6	AFDB:P18564	0.733	0.733	0.000	788	0.482	0.482	P18564.pdb.gz	ITB6_HUMAN Integrin beta-6 OS=Homo sapiens OX=9606 GN=ITGB6 PE=1 SV=2
7	AFDB:B3DHB6	0.589	0.584	2.061E-101	795	0.433	0.429	B3DHB6.pdb.gz
8	AFDB:F1N8N7	0.593	0.582	3.280E-101	803	0.444	0.436	F1N8N7.pdb.gz
9	AFDB:A0A286Y9W0	0.586	0.576	2.504E-100	802	0.439	0.431	A0A286Y9W0.pdb.gz
10	AFDB:P49134	0.581	0.573	5.765E-99	799	0.433	0.427	P49134.pdb.gz	ITB1_RAT Integrin beta-1 OS=Rattus norvegicus OX=10116 GN=Itgb1 PE=2 SV=1
11	AFDB:P11584	0.567	0.530	1.360E-93	846	0.396	0.369	P11584.pdb.gz	ITBX_DROME Integrin beta-PS OS=Drosophila melanogaster OX=7227 GN=mys PE=1 SV=3
12	AFDB:P26011	0.587	0.575	1.417E-91	806	0.395	0.386	P26011.pdb.gz	ITB7_MOUSE Integrin beta-7 OS=Mus musculus OX=10090 GN=Itgb7 PE=1 SV=2
13	PDB:7nxdB	0.586	0.665	2.413E-78	690	0.382	0.436	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
14	PDB:5es4B	0.646	0.747	2.630E-71	674	0.345	0.404	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
15	PDB:6ujaB	0.444	0.959	9.725E-47	359	0.180	0.396	6ujaB.pdb.gz	Cryo-EM Reveals Integrin-Mediated TGF-beta Activation without Release from Latent TGF-beta.
16	PDB:1m2vA	0.196	0.215	1.417E-8	705	0.055	0.061	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
17	PDB:6zgaB	0.183	0.184	1.417E-8	786	0.049	0.050	6zgaB.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
18	PDB:6zgaA	0.206	0.214	7.637E-8	751	0.047	0.049	6zgaA.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
19	PDB:5kynA	0.193	0.205	3.883E-7	730	0.057	0.062	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
20	PDB:7zs96	0.175	0.325	1.128E-5	383	0.043	0.089	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WXP3	739	693	0.443	0.504	A0A087WXP3_HUMAN Integrin beta OS=Homo sapiens OX=9606 GN=ITGB6 PE=1 SV=1
2	A0A494C0X7	548	769	0.390	0.399	A0A494C0X7_HUMAN Integrin beta OS=Homo sapiens OX=9606 GN=ITGB2 PE=1 SV=1
3	A0A8I5ZKE8	881	799	0.552	0.544	A0A8I5ZKE8_RAT Integrin beta OS=Rattus norvegicus OX=10116 GN=Itgb5 PE=1 SV=1
4	A0A8I6AQL1	851	813	0.537	0.520	A0A8I6AQL1_RAT Integrin beta OS=Rattus norvegicus OX=10116 GN=Itgb5 PE=1 SV=1
5	B2RYB8	544	768	0.391	0.401	B2RYB8_RAT Integrin beta OS=Rattus norvegicus OX=10116 GN=Itgb2 PE=3 SV=1
6	E9PEE8	791	746	0.475	0.501	E9PEE8_HUMAN Integrin beta OS=Homo sapiens OX=9606 GN=ITGB6 PE=1 SV=1
7	F1QG85	665	798	0.451	0.445	F1QG85_DANRE Integrin beta OS=Danio rerio OX=7955 GN=itgb1 PE=1 SV=1
8	L7RT22	873	799	0.549	0.542	L7RT22_HUMAN Integrin beta OS=Homo sapiens OX=9606 GN=ITGB5 PE=1 SV=1
9	O54890	1463	787	0.906	0.907	ITB3_MOUSE Integrin beta-3 OS=Mus musculus OX=10090 GN=Itgb3 PE=1 SV=2
10	O70309	883	798	0.551	0.544	ITB5_MOUSE Integrin beta-5 OS=Mus musculus OX=10090 GN=Itgb5 PE=1 SV=2
11	P05106	1628	788	1.000	1.000	ITB3_HUMAN Integrin beta-3 OS=Homo sapiens OX=9606 GN=ITGB3 PE=1 SV=2
12	P05107	550	769	0.391	0.401	ITB2_HUMAN Integrin beta-2 OS=Homo sapiens OX=9606 GN=ITGB2 PE=1 SV=2
13	P05556	659	798	0.444	0.439	ITB1_HUMAN Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2
14	P07228	665	803	0.454	0.446	ITB1_CHICK Integrin beta-1 OS=Gallus gallus OX=9031 GN=ITGB1 PE=1 SV=1
15	P09055	655	798	0.440	0.435	ITB1_MOUSE Integrin beta-1 OS=Mus musculus OX=10090 GN=Itgb1 PE=1 SV=1
16	P18084	873	799	0.549	0.542	ITB5_HUMAN Integrin beta-5 OS=Homo sapiens OX=9606 GN=ITGB5 PE=1 SV=1
17	P18564	812	788	0.491	0.491	ITB6_HUMAN Integrin beta-6 OS=Homo sapiens OX=9606 GN=ITGB6 PE=1 SV=2
18	P26010	557	798	0.386	0.381	ITB7_HUMAN Integrin beta-7 OS=Homo sapiens OX=9606 GN=ITGB7 PE=1 SV=1
19	P26011	553	806	0.393	0.385	ITB7_MOUSE Integrin beta-7 OS=Mus musculus OX=10090 GN=Itgb7 PE=1 SV=2
20	P49134	648	799	0.439	0.433	ITB1_RAT Integrin beta-1 OS=Rattus norvegicus OX=10116 GN=Itgb1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07974 EGF_2	1.6e-05	36.5	EGF-like domain
2	PF18372 I-EGF_1	2.4e-10	51.5	Integrin beta epidermal growth factor like domain 1
3	PF00362 Integrin_beta	1.8e-107	370.3	Integrin beta chain VWA domain
4	PF08725 Integrin_b_cyt	5.9e-17	72.4	Integrin beta cytoplasmic domain
5	PF07965 Integrin_B_tail	1.3e-16	72.1	Integrin beta tail domain
6	PF17205 PSI_integrin	1.1e-08	45.9	Integrin plexin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000452786

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261023	0.999	Integrin alpha-V
2	9606.ENSP00000262407	0.999	Integrin alpha-IIb
3	9606.ENSP00000346839	0.999	Fibronectin type III domain containing
4	9606.ENSP00000362680	0.999	Proto-oncogene tyrosine-protein kinase Src
5	9606.ENSP00000263923	0.998	Vascular endothelial growth factor receptor 2
6	9606.ENSP00000316029	0.998	Talin-1
7	9606.ENSP00000293379	0.997	Integrin alpha-5
8	9606.ENSP00000226218	0.996	Vitronectin
9	9606.ENSP00000341189	0.996	Focal adhesion kinase 1
10	9606.ENSP00000364907	0.993	Tyrosine-protein kinase SYK
11	9606.ENSP00000379975	0.991	Integrin-linked protein kinase
12	9606.ENSP00000380638	0.991	Protein-tyrosine kinase 2-beta
13	9606.ENSP00000351273	0.990	Caspase-8
14	9606.ENSP00000267257	0.988	Paxillin
15	9606.ENSP00000007722	0.984	Integrin alpha-3
16	9606.ENSP00000380227	0.984	Integrin alpha-4
17	9606.ENSP00000358866	0.983	Filamin-A
18	9606.ENSP00000351905	0.980	TGF-beta receptor type-2
19	9606.ENSP00000367316	0.978	Integrin alpha-8
20	9606.ENSP00000296585	0.977	Integrin alpha-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0044877	0.997	protein-containing complex binding
GO:0005102	0.985	signaling receptor binding
GO:0050839	0.958	cell adhesion molecule binding
GO:0005178	0.862	integrin binding
GO:0019899	0.847	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0051716	0.988	cellular response to stimulus
GO:0048518	0.979	positive regulation of biological process
GO:0007165	0.976	signal transduction
GO:0071840	0.975	cellular component organization or biogenesis
GO:0048522	0.974	positive regulation of cellular process
GO:0016043	0.969	cellular component organization
GO:0007166	0.961	cell surface receptor signaling pathway
GO:0007155	0.960	cell adhesion
GO:0032502	0.957	developmental process
GO:0032501	0.956	multicellular organismal process
GO:0040012	0.950	regulation of locomotion
GO:0007160	0.947	cell-matrix adhesion
GO:0007229	0.937	integrin-mediated signaling pathway
GO:0019222	0.934	regulation of metabolic process
GO:0030335	0.929	positive regulation of cell migration
GO:0007167	0.924	enzyme-linked receptor protein signaling pathway
GO:0060255	0.923	regulation of macromolecule metabolic process
GO:0098609	0.921	cell-cell adhesion
GO:0048856	0.920	anatomical structure development
GO:0009611	0.913	response to wounding
GO:0070848	0.911	response to growth factor
GO:0045785	0.903	positive regulation of cell adhesion
GO:0051239	0.900	regulation of multicellular organismal process
GO:0051174	0.894	regulation of phosphorus metabolic process
GO:0007275	0.893	multicellular organism development
GO:0048583	0.892	regulation of response to stimulus
GO:0048870	0.872	cell motility
GO:0009653	0.866	anatomical structure morphogenesis
GO:0048869	0.860	cellular developmental process
GO:0022603	0.859	regulation of anatomical structure morphogenesis
GO:0071495	0.856	cellular response to endogenous stimulus
GO:0080090	0.853	regulation of primary metabolic process
GO:0016477	0.850	cell migration
GO:0051171	0.849	regulation of nitrogen compound metabolic process
GO:0019220	0.848	regulation of phosphate metabolic process
GO:0007369	0.846	gastrulation
GO:0030036	0.840	actin cytoskeleton organization
GO:0042060	0.832	wound healing
GO:0009893	0.827	positive regulation of metabolic process
GO:0002682	0.822	regulation of immune system process
GO:0030154	0.812	cell differentiation
GO:0001775	0.808	cell activation
GO:0045937	0.805	positive regulation of phosphate metabolic process
GO:0032879	0.801	regulation of localization
GO:0065008	0.792	regulation of biological quality
GO:0042325	0.791	regulation of phosphorylation
GO:0008284	0.790	positive regulation of cell population proliferation
GO:0051247	0.790	positive regulation of protein metabolic process
GO:0044085	0.783	cellular component biogenesis
GO:0001932	0.783	regulation of protein phosphorylation
GO:0010810	0.781	regulation of cell-substrate adhesion
GO:0051338	0.778	regulation of transferase activity
GO:0048646	0.778	anatomical structure formation involved in morphogenesis
GO:0042327	0.775	positive regulation of phosphorylation
GO:0009966	0.769	regulation of signal transduction
GO:0071560	0.767	cellular response to transforming growth factor beta stimulus
GO:0051094	0.765	positive regulation of developmental process
GO:0051179	0.763	localization
GO:0048519	0.760	negative regulation of biological process
GO:0009888	0.758	tissue development
GO:0010468	0.756	regulation of gene expression
GO:0031401	0.756	positive regulation of protein modification process
GO:0022607	0.738	cellular component assembly
GO:0051240	0.726	positive regulation of multicellular organismal process
GO:0001704	0.720	formation of primary germ layer
GO:0048523	0.719	negative regulation of cellular process
GO:0044093	0.716	positive regulation of molecular function
GO:0042221	0.712	response to chemical
GO:0050730	0.707	regulation of peptidyl-tyrosine phosphorylation
GO:2000026	0.693	regulation of multicellular organismal development
GO:0048731	0.685	system development
GO:0031032	0.683	actomyosin structure organization
GO:0051128	0.681	regulation of cellular component organization
GO:0034330	0.680	cell junction organization
GO:0010762	0.671	regulation of fibroblast migration
GO:0051049	0.643	regulation of transport
GO:0045595	0.625	regulation of cell differentiation
GO:0048468	0.625	cell development
GO:0036119	0.596	response to platelet-derived growth factor
GO:0033627	0.564	cell adhesion mediated by integrin
GO:0034103	0.520	regulation of tissue remodeling
GO:0048584	0.504	positive regulation of response to stimulus
GO:0045124	0.500	regulation of bone resorption
GO:0023056	0.479	positive regulation of signaling
GO:0072359	0.479	circulatory system development
GO:0010647	0.458	positive regulation of cell communication
GO:0034446	0.444	substrate adhesion-dependent cell spreading
GO:0097435	0.439	supramolecular fiber organization
GO:0070887	0.420	cellular response to chemical stimulus
GO:0009967	0.412	positive regulation of signal transduction
GO:0008152	0.388	metabolic process
GO:0048729	0.370	tissue morphogenesis
GO:1902531	0.328	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005886	1.000	plasma membrane
GO:0009986	0.997	cell surface
GO:0005925	0.997	focal adhesion
GO:0098636	0.985	protein complex involved in cell adhesion
GO:0098802	0.985	plasma membrane signaling receptor complex
GO:0008305	0.983	integrin complex
GO:0043227	0.982	membrane-bounded organelle
GO:0043229	0.962	intracellular organelle
GO:0005576	0.947	extracellular region
GO:0005737	0.928	cytoplasm
GO:0043231	0.922	intracellular membrane-bounded organelle
GO:0098590	0.919	plasma membrane region
GO:0005615	0.883	extracellular space
GO:0031982	0.862	vesicle
GO:0070062	0.840	extracellular exosome
GO:0012505	0.660	endomembrane system
GO:0031410	0.638	cytoplasmic vesicle
GO:0045202	0.496	synapse
GO:0043233	0.467	organelle lumen
GO:0070013	0.454	intracellular organelle lumen
GO:0031090	0.349	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]