StarFunc result for job id P05107

User Input

>input (769 residues)
MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSI
RCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFV
NTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAM
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFD
YPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAY
NKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC
IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKN
CECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTIN
CERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNV
CECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGR
TCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLL
VIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5es4B	0.836	0.950	0.000	674	0.876	1.000	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
2	AFDB:A0A494C0X7	0.945	0.945	0.000	769	0.997	0.997	A0A494C0X7.pdb.gz	A0A494C0X7_HUMAN Integrin beta OS=Homo sapiens OX=9606 GN=ITGB2 PE=1 SV=1
3	AFDB:A8DSD5	0.676	0.676	0.000	769	0.836	0.836	A8DSD5.pdb.gz	A8DSD5_PIG Integrin beta OS=Sus scrofa OX=9823 PE=2 SV=1
4	AFDB:D3DSM0	0.798	0.858	0.000	712	0.925	0.999	D3DSM0.pdb.gz	D3DSM0_HUMAN Integrin beta OS=Homo sapiens OX=9606 GN=ITGB2 PE=1 SV=1
5	AFDB:P11835	0.918	0.916	0.000	771	0.821	0.818	P11835.pdb.gz	ITB2_MOUSE Integrin beta-2 OS=Mus musculus OX=10090 GN=Itgb2 PE=1 SV=2
6	AFDB:P32592	0.616	0.616	0.000	769	0.834	0.834	P32592.pdb.gz	ITB2_BOVIN Integrin beta-2 OS=Bos taurus OX=9913 GN=ITGB2 PE=1 SV=1
7	AFDB:Q9PUU4	0.616	0.614	8.130E-103	772	0.484	0.482	Q9PUU4.pdb.gz	Q9PUU4_ICTPU Integrin beta OS=Ictalurus punctatus OX=7998 GN=itgb2 PE=2 SV=1
8	AFDB:E7FCN5	0.597	0.598	1.435E-102	768	0.494	0.495	E7FCN5.pdb.gz	E7FCN5_DANRE Integrin beta OS=Danio rerio OX=7955 GN=itgb2 PE=1 SV=1
9	AFDB:F1N8N7	0.596	0.572	1.170E-99	803	0.467	0.447	F1N8N7.pdb.gz
10	AFDB:B3DHB6	0.597	0.578	1.239E-99	795	0.460	0.445	B3DHB6.pdb.gz
11	AFDB:Q3UV74	0.553	0.575	2.593E-99	738	0.558	0.581	Q3UV74.pdb.gz	ITB2L_MOUSE Integrin beta-2-like protein OS=Mus musculus OX=10090 GN=Itgb2l PE=1 SV=1
12	PDB:7nxdB	0.589	0.653	5.647E-79	690	0.408	0.455	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
13	PDB:4g1eB	0.630	0.678	1.524E-77	709	0.354	0.384	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
14	PDB:1u8cB	0.555	0.700	2.542E-60	599	0.312	0.401	1u8cB.pdb.gz	A novel adaptation of the integrin PSI domain revealed from its crystal structure.
15	PDB:6ujaB	0.450	0.946	4.256E-45	359	0.174	0.373	6ujaB.pdb.gz	Cryo-EM Reveals Integrin-Mediated TGF-beta Activation without Release from Latent TGF-beta.
16	PDB:6zgaB	0.197	0.194	4.617E-8	786	0.059	0.057	6zgaB.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
17	PDB:1m2vA	0.192	0.206	3.999E-7	705	0.057	0.062	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
18	PDB:6zgaA	0.202	0.206	7.471E-7	751	0.062	0.064	6zgaA.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
19	PDB:5kynA	0.209	0.218	1.752E-6	730	0.055	0.058	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
20	PDB:7zs96	0.191	0.358	1.280E-5	383	0.042	0.084	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A494C0X7	1580	769	0.999	0.999	A0A494C0X7_HUMAN Integrin beta OS=Homo sapiens OX=9606 GN=ITGB2 PE=1 SV=1
2	A0A8I5ZTY9	1216	762	0.770	0.777	A0A8I5ZTY9_RAT Integrin beta OS=Rattus norvegicus OX=10116 GN=Itgb2 PE=1 SV=1
3	A8DSD5	1299	769	0.822	0.822	A8DSD5_PIG Integrin beta OS=Sus scrofa OX=9823 PE=2 SV=1
4	B2RYB8	1267	768	0.813	0.814	B2RYB8_RAT Integrin beta OS=Rattus norvegicus OX=10116 GN=Itgb2 PE=3 SV=1
5	D3DSM0	1396	712	0.902	0.975	D3DSM0_HUMAN Integrin beta OS=Homo sapiens OX=9606 GN=ITGB2 PE=1 SV=1
6	E7FCN5	744	768	0.493	0.493	E7FCN5_DANRE Integrin beta OS=Danio rerio OX=7955 GN=itgb2 PE=1 SV=1
7	F1QG85	680	798	0.475	0.457	F1QG85_DANRE Integrin beta OS=Danio rerio OX=7955 GN=itgb1 PE=1 SV=1
8	O54890	553	787	0.402	0.393	ITB3_MOUSE Integrin beta-3 OS=Mus musculus OX=10090 GN=Itgb3 PE=1 SV=2
9	P05107	1582	769	1.000	1.000	ITB2_HUMAN Integrin beta-2 OS=Homo sapiens OX=9606 GN=ITGB2 PE=1 SV=2
10	P05556	686	798	0.475	0.457	ITB1_HUMAN Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2
11	P07228	692	803	0.466	0.446	ITB1_CHICK Integrin beta-1 OS=Gallus gallus OX=9031 GN=ITGB1 PE=1 SV=1
12	P09055	683	798	0.471	0.454	ITB1_MOUSE Integrin beta-1 OS=Mus musculus OX=10090 GN=Itgb1 PE=1 SV=1
13	P11835	1260	771	0.815	0.813	ITB2_MOUSE Integrin beta-2 OS=Mus musculus OX=10090 GN=Itgb2 PE=1 SV=2
14	P26010	695	798	0.472	0.455	ITB7_HUMAN Integrin beta-7 OS=Homo sapiens OX=9606 GN=ITGB7 PE=1 SV=1
15	P26011	677	806	0.467	0.445	ITB7_MOUSE Integrin beta-7 OS=Mus musculus OX=10090 GN=Itgb7 PE=1 SV=2
16	P32592	1278	769	0.819	0.819	ITB2_BOVIN Integrin beta-2 OS=Bos taurus OX=9913 GN=ITGB2 PE=1 SV=1
17	P49134	672	799	0.466	0.448	ITB1_RAT Integrin beta-1 OS=Rattus norvegicus OX=10116 GN=Itgb1 PE=2 SV=1
18	P53714	1295	769	0.818	0.818	ITB2_PIG Integrin beta-2 OS=Sus scrofa OX=9823 GN=ITGB2 PE=2 SV=1
19	Q3LTM5	542	790	0.398	0.387	Q3LTM5_DANRE Integrin beta OS=Danio rerio OX=7955 GN=itgb3.1 PE=2 SV=1
20	Q3UV74	828	738	0.551	0.575	ITB2L_MOUSE Integrin beta-2-like protein OS=Mus musculus OX=10090 GN=Itgb2l PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07974 EGF_2	30	16.4	EGF-like domain
2	PF18372 I-EGF_1	0.82	21.0	Integrin beta epidermal growth factor like domain 1
3	PF00362 Integrin_beta	5e-108	372.1	Integrin beta chain VWA domain
4	PF08725 Integrin_b_cyt	1.7e-13	61.3	Integrin beta cytoplasmic domain
5	PF07965 Integrin_B_tail	4e-11	54.5	Integrin beta tail domain
6	PF17205 PSI_integrin	8.6e-10	49.5	Integrin plexin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380948

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264832	0.999	Intercellular adhesion molecule 1
2	9606.ENSP00000349252	0.999	Integrin alpha-L
3	9606.ENSP00000441691	0.999	Integrin alpha-M
4	9606.ENSP00000454623	0.999	Integrin alpha-X
5	9606.ENSP00000294728	0.996	Vascular cell adhesion protein 1
6	9606.ENSP00000373854	0.988	Integrin alpha-D
7	9606.ENSP00000415283	0.986	Intercellular adhesion molecule 2
8	9606.ENSP00000160262	0.984	Intercellular adhesion molecule 3
9	9606.ENSP00000329380	0.984	Platelet glycoprotein Ib alpha chain
10	9606.ENSP00000380227	0.983	Integrin alpha-4
11	9606.ENSP00000444986	0.982	Tyrosine-protein kinase HCK
12	9606.ENSP00000293379	0.980	Integrin alpha-5
13	9606.ENSP00000007722	0.977	Integrin alpha-3
14	9606.ENSP00000228463	0.977	P-selectin glycoprotein ligand 1
15	9606.ENSP00000299106	0.977	Junctional adhesion molecule C
16	9606.ENSP00000316029	0.977	Talin-1
17	9606.ENSP00000261023	0.974	Integrin alpha-V
18	9606.ENSP00000359663	0.972	CD40 ligand
19	9606.ENSP00000367316	0.970	Integrin alpha-8
20	9606.ENSP00000263686	0.969	P-selectin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.991	protein-containing complex binding
GO:0050839	0.977	cell adhesion molecule binding
GO:0019899	0.939	enzyme binding
GO:0005102	0.934	signaling receptor binding
GO:0005178	0.831	integrin binding
GO:0019901	0.489	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0051716	0.996	cellular response to stimulus
GO:0048518	0.991	positive regulation of biological process
GO:0007165	0.991	signal transduction
GO:0007166	0.981	cell surface receptor signaling pathway
GO:0032879	0.977	regulation of localization
GO:0050900	0.955	leukocyte migration
GO:0032501	0.944	multicellular organismal process
GO:0007229	0.941	integrin-mediated signaling pathway
GO:0007155	0.925	cell adhesion
GO:0060627	0.923	regulation of vesicle-mediated transport
GO:0051239	0.921	regulation of multicellular organismal process
GO:0098609	0.919	cell-cell adhesion
GO:0048522	0.905	positive regulation of cellular process
GO:0051050	0.875	positive regulation of transport
GO:0002682	0.853	regulation of immune system process
GO:0006952	0.848	defense response
GO:0051240	0.819	positive regulation of multicellular organismal process
GO:0019222	0.799	regulation of metabolic process
GO:0045123	0.762	cellular extravasation
GO:0080090	0.758	regulation of primary metabolic process
GO:0060255	0.758	regulation of macromolecule metabolic process
GO:0001775	0.755	cell activation
GO:0051171	0.733	regulation of nitrogen compound metabolic process
GO:0050764	0.731	regulation of phagocytosis
GO:0042221	0.723	response to chemical
GO:0031325	0.722	positive regulation of cellular metabolic process
GO:0051179	0.711	localization
GO:0007159	0.691	leukocyte cell-cell adhesion
GO:0009605	0.683	response to external stimulus
GO:0070887	0.654	cellular response to chemical stimulus
GO:0032502	0.653	developmental process
GO:0048583	0.621	regulation of response to stimulus
GO:0050766	0.592	positive regulation of phagocytosis
GO:0048856	0.569	anatomical structure development
GO:0002684	0.521	positive regulation of immune system process
GO:0006935	0.490	chemotaxis
GO:0030595	0.456	leukocyte chemotaxis
GO:0097529	0.417	myeloid leukocyte migration
GO:0071621	0.414	granulocyte chemotaxis
GO:0048584	0.410	positive regulation of response to stimulus
GO:0045321	0.380	leukocyte activation
GO:0031589	0.374	cell-substrate adhesion
GO:0048519	0.371	negative regulation of biological process
GO:0071840	0.366	cellular component organization or biogenesis
GO:0065009	0.339	regulation of molecular function
GO:0007160	0.334	cell-matrix adhesion
GO:0010646	0.327	regulation of cell communication
GO:0010468	0.323	regulation of gene expression
GO:0023051	0.321	regulation of signaling
GO:0016043	0.321	cellular component organization
GO:0006954	0.320	inflammatory response
GO:0030155	0.314	regulation of cell adhesion
GO:0048523	0.314	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.947	organelle
GO:0005622	0.939	intracellular anatomical structure
GO:0043227	0.939	membrane-bounded organelle
GO:0032991	0.888	protein-containing complex
GO:0043231	0.849	intracellular membrane-bounded organelle
GO:0005737	0.829	cytoplasm
GO:0031982	0.734	vesicle
GO:0005576	0.675	extracellular region
GO:0098802	0.649	plasma membrane signaling receptor complex
GO:0098636	0.647	protein complex involved in cell adhesion
GO:0009986	0.586	cell surface
GO:0012505	0.566	endomembrane system
GO:0030141	0.519	secretory granule
GO:0008305	0.510	integrin complex
GO:0005615	0.433	extracellular space
GO:0031090	0.415	organelle membrane
GO:0070062	0.365	extracellular exosome
GO:0098588	0.364	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]