StarFunc result for job id P05108

User Input

>input (521 residues)
MLAKGLPPRSVLVKGCQTFLSAPREGLGRLRVPTGEGAGISTRSPRPFNEIPSPGDNGWL
NLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPER
FLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVS
VLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQM
FHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRG
ILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAAR
HQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIY
ALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINML
ENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05108	1.000	1.000	1.085E-82	521	1.000	1.000	P05108.pdb.gz	CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=CYP11A1 PE=1 SV=2
2	PDB:3na1A	0.905	0.999	5.418E-72	472	0.906	1.000	3na1A.pdb.gz	Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.
3	AFDB:P14137	0.917	0.908	6.396E-69	526	0.764	0.757	P14137.pdb.gz	CP11A_RAT Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11a1 PE=1 SV=1
4	AFDB:Q9QZ82	0.923	0.915	8.413E-69	526	0.752	0.745	Q9QZ82.pdb.gz	CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus OX=10090 GN=Cyp11a1 PE=1 SV=1
5	AFDB:P00189	0.926	0.928	1.796E-67	520	0.727	0.729	P00189.pdb.gz	CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus OX=9913 GN=CYP11A1 PE=1 SV=1
6	PDB:3mzsA	0.889	0.985	1.781E-56	470	0.668	0.740	3mzsA.pdb.gz	Structural Basis for Three-step Sequential Catalysis by the Cholesterol Side Chain Cleavage Enzyme CYP11A1.
7	AFDB:A0A2R8Q770	0.883	0.878	2.767E-48	524	0.461	0.458	A0A2R8Q770.pdb.gz
8	AFDB:A8KC03	0.887	0.908	8.514E-47	509	0.449	0.460	A8KC03.pdb.gz
9	AFDB:A9JRV2	0.885	0.737	2.951E-44	628	0.415	0.344	A9JRV2.pdb.gz
10	AFDB:P30099	0.870	0.888	9.950E-43	510	0.370	0.378	P30099.pdb.gz	C11B2_RAT Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11b2 PE=1 SV=1
11	AFDB:P15538	0.871	0.901	2.925E-41	503	0.365	0.378	P15538.pdb.gz	C11B1_HUMAN Cytochrome P450 11B1, mitochondrial OS=Homo sapiens OX=9606 GN=CYP11B1 PE=1 SV=5
12	AFDB:Q3TG86	0.860	0.893	2.286E-40	501	0.344	0.357	Q3TG86.pdb.gz	Q3TG86_MOUSE steroid 11beta-monooxygenase OS=Mus musculus OX=10090 GN=Cyp11b1 PE=1 SV=1
13	PDB:7m8iA	0.851	0.777	1.297E-36	572	0.353	0.322	7m8iA.pdb.gz	Structural and functional insights into aldosterone synthase interaction with its redox partner protein adrenodoxin.
14	PDB:3k9vA	0.799	0.890	7.101E-29	464	0.271	0.304	3k9vA.pdb.gz	Crystal structure of CYP24A1, a mitochondrial cytochrome P450 involved in vitamin D metabolism.
15	PDB:5veuC	0.726	0.801	2.602E-19	469	0.200	0.222	5veuC.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
16	PDB:7cb9A	0.732	0.811	9.353E-19	466	0.184	0.206	7cb9A.pdb.gz	CYP76AH1 from Salvia miltiorrhiza
17	PDB:4nz2A	0.686	0.762	1.230E-18	464	0.180	0.203	4nz2A.pdb.gz	Structure-based ligand design to overcome CYP inhibition in drug discovery projects.
18	PDB:4y8wC	0.694	0.806	1.230E-18	442	0.188	0.222	4y8wC.pdb.gz	Human Cytochrome P450 21A2, the Major Steroid 21-Hydroxylase: STRUCTURE OF THE ENZYMEPROGESTERONE SUBSTRATE COMPLEX AND RATE-LIMITING C-H BOND CLEAVAGE.
19	PDB:5te8B	0.718	0.787	1.348E-18	471	0.194	0.214	5te8B.pdb.gz	Structural basis for regiospecific midazolam oxidation by human cytochrome P450 3A4.
20	PDB:7n3mAAA	0.685	0.807	2.800E-18	437	0.161	0.192	7n3mAAA.pdb.gz	Discovery of Novel 3-Piperidinyl Pyridine Derivatives as Highly Potent and Selective Cholesterol 24-Hydroxylase (CH24H) Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P00189	0.0	806	520	0.727	0.729	CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus OX=9913 GN=CYP11A1 PE=1 SV=1
2	P05108	0.0	1083	521	1.000	1.000	CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=CYP11A1 PE=1 SV=2
3	P14137	0.0	838	526	0.764	0.757	CP11A_RAT Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11a1 PE=1 SV=1
4	Q9QZ82	0.0	828	526	0.752	0.745	CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus OX=10090 GN=Cyp11a1 PE=1 SV=1
5	Q7SYJ6	1.18e-167	486	509	0.447	0.458	Q7SYJ6_DANRE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Danio rerio OX=7955 GN=cyp11a1.1 PE=1 SV=1
6	A1XRK1	1.32e-137	409	518	0.413	0.415	A1XRK1_DANRE Cytochrome P450, family 11, subfamily C, polypeptide 1 OS=Danio rerio OX=7955 GN=cyp11b2 PE=1 SV=1
7	P30099	5.37e-116	353	510	0.369	0.376	C11B2_RAT Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11b2 PE=1 SV=1
8	P30100	2.13e-115	352	500	0.367	0.382	C11B3_RAT Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11b3 PE=1 SV=1
9	P15539	2.11e-112	344	500	0.359	0.374	C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus OX=10090 GN=Cyp11b2 PE=2 SV=3
10	Q3TG86	2.74e-111	341	501	0.342	0.355	Q3TG86_MOUSE steroid 11beta-monooxygenase OS=Mus musculus OX=10090 GN=Cyp11b1 PE=1 SV=1
11	Q3UQH5	3.40e-111	341	501	0.342	0.355	Q3UQH5_MOUSE steroid 11beta-monooxygenase OS=Mus musculus OX=10090 GN=Cyp11b1 PE=2 SV=1
12	Q3TR45	7.95e-110	337	498	0.342	0.357	Q3TR45_MOUSE steroid 11beta-monooxygenase OS=Mus musculus OX=10090 GN=Cyp11b1 PE=2 SV=1
13	P19099	1.50e-108	334	503	0.370	0.384	C11B2_HUMAN Cytochrome P450 11B2, mitochondrial OS=Homo sapiens OX=9606 GN=CYP11B2 PE=1 SV=3
14	P15393	5.06e-107	330	499	0.347	0.363	C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11b1 PE=1 SV=1
15	P15538	6.73e-104	322	503	0.357	0.370	C11B1_HUMAN Cytochrome P450 11B1, mitochondrial OS=Homo sapiens OX=9606 GN=CYP11B1 PE=1 SV=5
16	A0A097HUX0	2.50e-75	248	505	0.288	0.297	A0A097HUX0_DANRE 25-hydroxyvitamin D-1alpha-hydroxylase OS=Danio rerio OX=7955 GN=cyp27b1 PE=2 SV=1
17	O15528	1.60e-70	236	508	0.294	0.301	CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP27B1 PE=1 SV=1
18	O35132	3.31e-70	234	501	0.305	0.317	CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp27b1 PE=2 SV=2
19	O35084	1.48e-67	228	507	0.303	0.312	CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp27b1 PE=1 SV=2
20	Q07973	9.04e-67	226	514	0.280	0.284	CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP24A1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00067 p450	1.8e-121	417.8	Cytochrome P450

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268053

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260270	0.999	Adrenodoxin, mitochondrial
2	9606.ENSP00000358421	0.994	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
3	9606.ENSP00000445122	0.989	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
4	9606.ENSP00000276449	0.976	Steroidogenic acute regulatory protein, mitochondrial
5	9606.ENSP00000358903	0.956	Steroid 17-alpha-hydroxylase/17,20 lyase
6	9606.ENSP00000416515	0.954	NADPH:adrenodoxin oxidoreductase, mitochondrial
7	9606.ENSP00000408860	0.949	Steroid 21-hydroxylase
8	9606.ENSP00000201586	0.935	Sulfotransferase family cytosolic 2B member 1
9	9606.ENSP00000217961	0.934	Steryl-sulfatase
10	9606.ENSP00000310721	0.916	25-hydroxycholesterol 7-alpha-hydroxylase
11	9606.ENSP00000347717	0.896	7-dehydrocholesterol reductase
12	9606.ENSP00000362690	0.867	Steroidogenic factor 1
13	9606.ENSP00000360316	0.855	Delta(24)-sterol reductase
14	9606.ENSP00000356591	0.849	Sterol O-acyltransferase 1
15	9606.ENSP00000361151	0.828	Bile salt-activated lipase
16	9606.ENSP00000301466	0.821	Sterol O-acyltransferase 2
17	9606.ENSP00000337354	0.820	Lysosomal acid lipase/cholesteryl ester hydrolase
18	9606.ENSP00000294954	0.818	Lutropin-choriogonadotropic hormone receptor
19	9606.ENSP00000466799	0.816	Estradiol 17-beta-dehydrogenase 1
20	9606.ENSP00000364412	0.780	Testosterone 17-beta-dehydrogenase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008395	1.000	steroid hydroxylase activity
GO:0016713	1.000	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen
GO:0020037	0.999	heme binding
GO:0005515	0.725	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006694	0.996	steroid biosynthetic process
GO:1901615	0.993	organic hydroxy compound metabolic process
GO:0120178	0.993	steroid hormone biosynthetic process
GO:0009987	0.992	cellular process
GO:0065007	0.986	biological regulation
GO:0006066	0.947	alcohol metabolic process
GO:0042445	0.941	hormone metabolic process
GO:0044237	0.923	cellular metabolic process
GO:0008203	0.911	cholesterol metabolic process
GO:0042446	0.856	hormone biosynthetic process
GO:0008207	0.737	C21-steroid hormone metabolic process
GO:0044249	0.690	cellular biosynthetic process
GO:0050789	0.358	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005739	0.991	mitochondrion
GO:0070013	0.990	intracellular organelle lumen
GO:0031090	0.892	organelle membrane
GO:0031981	0.383	nuclear lumen
GO:0005654	0.313	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:43836	1.000	cholesterol + H(+) + NADPH + O2 = 26-hydroxycholesterol + H2O + NADP(+)
EC:1.14.15.-	1.000	With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen.

[back to server]