StarFunc result for job id P05109

User Input

>input (93 residues)
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDI
NTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05109	1.000	1.000	2.379E-16	93	1.000	1.000	P05109.pdb.gz	S10A8_HUMAN Protein S100-A8 OS=Homo sapiens OX=9606 GN=S100A8 PE=1 SV=1
2	PDB:5hloC	0.927	0.927	1.058E-13	93	0.989	0.989	5hloC.pdb.gz	Crystal structure of human S100A8 in complex with zinc and calcium.
3	AFDB:P50115	0.885	0.923	1.757E-10	89	0.613	0.640	P50115.pdb.gz	S10A8_RAT Protein S100-A8 OS=Rattus norvegicus OX=10116 GN=S100a8 PE=1 SV=3
4	AFDB:P27005	0.858	0.894	7.716E-10	89	0.570	0.596	P27005.pdb.gz	S10A8_MOUSE Protein S100-A8 OS=Mus musculus OX=10090 GN=S100a8 PE=1 SV=3
5	AFDB:P80511	0.866	0.875	2.083E-7	92	0.376	0.380	P80511.pdb.gz	S10AC_HUMAN Protein S100-A12 OS=Homo sapiens OX=9606 GN=S100A12 PE=1 SV=2
6	AFDB:P80310	0.865	0.873	3.716E-7	92	0.323	0.326	P80310.pdb.gz	S10AC_PIG Protein S100-A12 OS=Sus scrofa OX=9823 GN=S100A12 PE=1 SV=2
7	AFDB:P79105	0.873	0.882	4.807E-7	92	0.344	0.348	P79105.pdb.gz	S10AC_BOVIN Protein S100-A12 OS=Bos taurus OX=9913 GN=S100A12 PE=1 SV=3
8	AFDB:P25815	0.845	0.828	5.467E-7	95	0.355	0.347	P25815.pdb.gz	S100P_HUMAN Protein S100-P OS=Homo sapiens OX=9606 GN=S100P PE=1 SV=2
9	AFDB:P50543	0.858	0.818	8.043E-7	98	0.344	0.327	P50543.pdb.gz	S10AB_MOUSE Protein S100-A11 OS=Mus musculus OX=10090 GN=S100a11 PE=1 SV=1
10	AFDB:Q9UBG3	0.877	0.177	1.980E-6	495	0.355	0.067	Q9UBG3.pdb.gz	CRNN_HUMAN Cornulin OS=Homo sapiens OX=9606 GN=CRNN PE=1 SV=1
11	AFDB:A0A060YDS7	0.832	0.816	2.112E-6	95	0.280	0.274	A0A060YDS7.pdb.gz	A0A060YDS7_ONCMY S100 calcium binding protein, beta (neural) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00040819001 PE=4 SV=1
12	PDB:5csnA	0.810	0.803	4.502E-6	94	0.323	0.319	5csnA.pdb.gz	Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
13	PDB:2kayA	0.829	0.837	1.039E-5	92	0.301	0.304	2kayA.pdb.gz	Solution structure and dynamics of S100A5 in the apo and Ca2+-bound states
14	PDB:7psqG	0.795	0.698	1.260E-5	108	0.290	0.250	7psqG.pdb.gz	Crystal structure of S100A4 labeled with NU074381b.
15	PDB:6zdyA	0.834	0.726	1.630E-5	108	0.247	0.213	6zdyA.pdb.gz	Divalent cations influence the dimerization mode of murine S100A9 protein by modulating its disulfide bond pattern.
16	PDB:2wc8D	0.702	0.702	2.398E-5	93	0.409	0.409	2wc8D.pdb.gz	The Crystal Structures of Human S100A12 in Apo Form and in Complex with Zinc: New Insights Into S100A12 Oligomerisation.
17	PDB:1k96A	0.811	0.845	2.558E-5	89	0.226	0.236	1k96A.pdb.gz	Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
18	PDB:2k2fA	0.711	0.711	7.161E-5	93	0.344	0.344	2k2fA.pdb.gz	S100A1 and Calmodulin Compete for the Same Binding Site on Ryanodine Receptor.
19	PDB:2lucA	0.780	0.699	1.124E-4	105	0.269	0.238	2lucA.pdb.gz
20	PDB:2rgiA	0.633	0.633	2.432E-4	93	0.280	0.280	2rgiA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05109	8.16e-65	192	93	1.000	1.000	S10A8_HUMAN Protein S100-A8 OS=Homo sapiens OX=9606 GN=S100A8 PE=1 SV=1
2	P50115	8.95e-41	131	89	0.602	0.629	S10A8_RAT Protein S100-A8 OS=Rattus norvegicus OX=10116 GN=S100a8 PE=1 SV=3
3	P27005	1.42e-36	120	89	0.559	0.584	S10A8_MOUSE Protein S100-A8 OS=Mus musculus OX=10090 GN=S100a8 PE=1 SV=3
4	P25815	6.96e-15	65.9	95	0.355	0.347	S100P_HUMAN Protein S100-P OS=Homo sapiens OX=9606 GN=S100P PE=1 SV=2
5	P79105	1.90e-14	64.7	92	0.355	0.359	S10AC_BOVIN Protein S100-A12 OS=Bos taurus OX=9913 GN=S100A12 PE=1 SV=3
6	P80511	1.78e-13	62.0	92	0.387	0.391	S10AC_HUMAN Protein S100-A12 OS=Homo sapiens OX=9606 GN=S100A12 PE=1 SV=2
7	P35467	3.76e-13	61.2	94	0.376	0.372	S10A1_RAT Protein S100-A1 OS=Rattus norvegicus OX=10116 GN=S100a1 PE=1 SV=3
8	P80310	4.31e-13	61.2	92	0.333	0.337	S10AC_PIG Protein S100-A12 OS=Sus scrofa OX=9823 GN=S100A12 PE=1 SV=2
9	P02639	1.18e-12	60.1	94	0.366	0.362	S10A1_BOVIN Protein S100-A1 OS=Bos taurus OX=9913 GN=S100A1 PE=1 SV=2
10	A0A0S2Z4H2	1.49e-12	59.7	94	0.344	0.340	A0A0S2Z4H2_HUMAN Protein S100 (Fragment) OS=Homo sapiens OX=9606 GN=S100A1 PE=2 SV=1
11	P23297	1.49e-12	59.7	94	0.344	0.340	S10A1_HUMAN Protein S100-A1 OS=Homo sapiens OX=9606 GN=S100A1 PE=1 SV=2
12	Q5T7Y6	3.27e-12	60.1	147	0.344	0.218	Q5T7Y6_HUMAN Protein S100 OS=Homo sapiens OX=9606 GN=S100A1 PE=1 SV=1
13	Q5XJJ5	7.88e-12	58.2	102	0.323	0.294	Q5XJJ5_DANRE Protein S100 OS=Danio rerio OX=7955 GN=zgc:101880 PE=2 SV=1
14	P56565	9.76e-12	57.8	94	0.355	0.351	S10A1_MOUSE Protein S100-A1 OS=Mus musculus OX=10090 GN=S100a1 PE=1 SV=2
15	P02638	1.32e-11	57.4	92	0.312	0.315	S100B_BOVIN Protein S100-B OS=Bos taurus OX=9913 GN=S100B PE=1 SV=2
16	P50114	1.32e-11	57.4	92	0.312	0.315	S100B_MOUSE Protein S100-B OS=Mus musculus OX=10090 GN=S100b PE=1 SV=2
17	A0A0S2Z4C5	1.39e-11	57.4	92	0.312	0.315	A0A0S2Z4C5_HUMAN Protein S100 (Fragment) OS=Homo sapiens OX=9606 GN=S100B PE=2 SV=1
18	P04271	1.39e-11	57.4	92	0.312	0.315	S100B_HUMAN Protein S100-B OS=Homo sapiens OX=9606 GN=S100B PE=1 SV=2
19	P04631	1.77e-11	57.0	92	0.312	0.315	S100B_RAT Protein S100-B OS=Rattus norvegicus OX=10116 GN=S100b PE=1 SV=2
20	P50543	2.97e-11	56.6	98	0.333	0.316	S10AB_MOUSE Protein S100-A11 OS=Mus musculus OX=10090 GN=S100a11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	0.24	22.1	EF hand
2	PF08976 EF-hand_11	4.9e+02	13.0	EF-hand domain
3	PF13202 EF-hand_5	5.3	17.9	EF hand
4	PF13405 EF-hand_6	59	14.9	EF-hand domain
5	PF13499 EF-hand_7	0.078	24.8	EF-hand domain pair
6	PF13833 EF-hand_8	2.1	19.5	EF-hand domain pair
7	PF01023 S_100	1.9e-12	57.9	S-100/ICaBP type calcium binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357722

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357727	0.999	Protein S100-A9
2	9606.ENSP00000340944	0.989	Tyrosine-protein phosphatase non-receptor type 11
3	9606.ENSP00000376345	0.989	Growth factor receptor-bound protein 2
4	9606.ENSP00000261769	0.988	Cadherin-1
5	9606.ENSP00000281537	0.988	Tight junction protein ZO-1
6	9606.ENSP00000317272	0.987	Hepatocyte growth factor receptor
7	9606.ENSP00000385751	0.986	Serine/threonine-protein kinase MARK2
8	9606.ENSP00000357726	0.985	Protein S100-A12
9	9606.ENSP00000362680	0.983	Proto-oncogene tyrosine-protein kinase Src
10	9606.ENSP00000341957	0.977	Apoptosis-stimulating of p53 protein 2
11	9606.ENSP00000363089	0.972	Toll-like receptor 4
12	9606.ENSP00000284818	0.951	Lymphocyte antigen 96
13	9606.ENSP00000358997	0.927	Interleukin-1 receptor-associated kinase 1
14	9606.ENSP00000401399	0.925	Myeloid differentiation primary response protein MyD88
15	9606.ENSP00000356505	0.920	Neutrophil cytosol factor 2
16	9606.ENSP00000376445	0.903	Toll/interleukin-1 receptor domain-containing adapter protein
17	9606.ENSP00000220003	0.901	Tyrosine-protein kinase CSK
18	9606.ENSP00000398632	0.883	CD44 antigen
19	9606.ENSP00000300574	0.880	Adapter molecule crk
20	9606.ENSP00000379350	0.820	Integrin beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005509	1.000	calcium ion binding
GO:0036094	0.997	small molecule binding
GO:0043177	0.989	organic acid binding
GO:0005102	0.976	signaling receptor binding
GO:0008092	0.952	cytoskeletal protein binding
GO:0008289	0.903	lipid binding
GO:0043168	0.889	anion binding
GO:0005504	0.876	fatty acid binding
GO:0046914	0.872	transition metal ion binding
GO:0008270	0.858	zinc ion binding
GO:0042802	0.821	identical protein binding
GO:0036041	0.719	long-chain fatty acid binding
GO:0008017	0.646	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0009987	0.992	cellular process
GO:0065007	0.985	biological regulation
GO:0042221	0.982	response to chemical
GO:0050794	0.976	regulation of cellular process
GO:0006954	0.950	inflammatory response
GO:0048518	0.938	positive regulation of biological process
GO:0048583	0.907	regulation of response to stimulus
GO:0031323	0.894	regulation of cellular metabolic process
GO:0009893	0.892	positive regulation of metabolic process
GO:0048522	0.888	positive regulation of cellular process
GO:0071704	0.883	organic substance metabolic process
GO:0044238	0.861	primary metabolic process
GO:0009605	0.860	response to external stimulus
GO:0080090	0.854	regulation of primary metabolic process
GO:0051171	0.853	regulation of nitrogen compound metabolic process
GO:0051716	0.843	cellular response to stimulus
GO:0044419	0.836	biological process involved in interspecies interaction between organisms
GO:0044093	0.832	positive regulation of molecular function
GO:0009607	0.827	response to biotic stimulus
GO:0050900	0.825	leukocyte migration
GO:0010604	0.821	positive regulation of macromolecule metabolic process
GO:0006807	0.813	nitrogen compound metabolic process
GO:0051707	0.806	response to other organism
GO:0007155	0.802	cell adhesion
GO:0043085	0.799	positive regulation of catalytic activity
GO:0051090	0.787	regulation of DNA-binding transcription factor activity
GO:0048584	0.784	positive regulation of response to stimulus
GO:0043170	0.778	macromolecule metabolic process
GO:0051247	0.774	positive regulation of protein metabolic process
GO:0023051	0.769	regulation of signaling
GO:0010646	0.755	regulation of cell communication
GO:1901564	0.735	organonitrogen compound metabolic process
GO:0009617	0.733	response to bacterium
GO:0051091	0.727	positive regulation of DNA-binding transcription factor activity
GO:0051092	0.707	positive regulation of NF-kappaB transcription factor activity
GO:0019538	0.700	protein metabolic process
GO:0030595	0.696	leukocyte chemotaxis
GO:0051179	0.693	localization
GO:0098609	0.677	cell-cell adhesion
GO:0097529	0.653	myeloid leukocyte migration
GO:0007154	0.627	cell communication
GO:0097530	0.603	granulocyte migration
GO:0009966	0.597	regulation of signal transduction
GO:0023052	0.591	signaling
GO:1902533	0.576	positive regulation of intracellular signal transduction
GO:0080134	0.575	regulation of response to stress
GO:0007159	0.574	leukocyte cell-cell adhesion
GO:0036211	0.573	protein modification process
GO:1990266	0.544	neutrophil migration
GO:0071621	0.539	granulocyte chemotaxis
GO:0032103	0.529	positive regulation of response to external stimulus
GO:0044237	0.505	cellular metabolic process
GO:0031347	0.502	regulation of defense response
GO:0032501	0.497	multicellular organismal process
GO:0051235	0.478	maintenance of location
GO:0048519	0.440	negative regulation of biological process
GO:0030593	0.433	neutrophil chemotaxis
GO:0031349	0.427	positive regulation of defense response
GO:0032502	0.424	developmental process
GO:0048856	0.411	anatomical structure development
GO:0010033	0.405	response to organic substance
GO:0051238	0.382	sequestering of metal ion
GO:0018193	0.341	peptidyl-amino acid modification
GO:0051336	0.321	regulation of hydrolase activity
GO:0098542	0.319	defense response to other organism
GO:0002523	0.312	leukocyte migration involved in inflammatory response
GO:0031325	0.309	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005576	0.996	extracellular region
GO:0012505	0.995	endomembrane system
GO:0031982	0.991	vesicle
GO:0070013	0.986	intracellular organelle lumen
GO:0005886	0.977	plasma membrane
GO:0005615	0.967	extracellular space
GO:0031410	0.958	cytoplasmic vesicle
GO:0005829	0.955	cytosol
GO:0005634	0.947	nucleus
GO:0043232	0.940	intracellular non-membrane-bounded organelle
GO:0099503	0.869	secretory vesicle
GO:0030141	0.861	secretory granule
GO:0065010	0.790	extracellular membrane-bounded organelle
GO:0070062	0.783	extracellular exosome
GO:0031983	0.717	vesicle lumen
GO:0060205	0.699	cytoplasmic vesicle lumen
GO:0031981	0.559	nuclear lumen
GO:0034774	0.548	secretory granule lumen
GO:0030312	0.454	external encapsulating structure
GO:0031012	0.425	extracellular matrix
GO:0005856	0.404	cytoskeleton
GO:0005654	0.382	nucleoplasm
GO:0062023	0.377	collagen-containing extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]