StarFunc result for job id P05111

User Input

>input (366 residues)
MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPR
RHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQH
TRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLH
LATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWP
WSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIP
PNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLT
QHCACI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05111	1.000	1.000	4.284E-70	366	1.000	1.000	P05111.pdb.gz	INHA_HUMAN Inhibin alpha chain OS=Homo sapiens OX=9606 GN=INHA PE=1 SV=1
2	AFDB:P17490	0.434	0.434	8.688E-54	366	0.770	0.770	P17490.pdb.gz	INHA_RAT Inhibin alpha chain OS=Rattus norvegicus OX=10116 GN=Inha PE=2 SV=1
3	AFDB:P58166	0.320	0.334	4.081E-15	350	0.238	0.249	P58166.pdb.gz	INHBE_HUMAN Inhibin beta E chain OS=Homo sapiens OX=9606 GN=INHBE PE=1 SV=1
4	AFDB:P55103	0.355	0.362	1.622E-13	352	0.224	0.233	P55103.pdb.gz	INHBC_HUMAN Inhibin beta C chain OS=Homo sapiens OX=9606 GN=INHBC PE=2 SV=1
5	AFDB:Q91350	0.327	0.325	1.715E-13	370	0.202	0.200	Q91350.pdb.gz	Q91350_XENLA Inhibin beta B chain OS=Xenopus laevis OX=8355 GN=inhbb.L PE=2 SV=1
6	AFDB:P55105	0.267	0.247	1.598E-12	399	0.183	0.168	P55105.pdb.gz	BMP8B_MOUSE Bone morphogenetic protein 8B OS=Mus musculus OX=10090 GN=Bmp8b PE=1 SV=2
7	AFDB:Q9VQG9	0.292	0.192	2.496E-12	586	0.167	0.104	Q9VQG9.pdb.gz	Q9VQG9_DROME Dawdle, isoform A OS=Drosophila melanogaster OX=7227 GN=daw PE=2 SV=1
8	PDB:5hlyA	0.399	0.466	3.308E-12	299	0.161	0.197	5hlyA.pdb.gz
9	AFDB:P34821	0.277	0.256	4.361E-12	399	0.208	0.190	P34821.pdb.gz	BMP8A_MOUSE Bone morphogenetic protein 8A OS=Mus musculus OX=10090 GN=Bmp8a PE=2 SV=1
10	AFDB:O61643	0.260	0.132	8.519E-12	946	0.172	0.067	O61643.pdb.gz	INHB_DROME Inhibin beta chain OS=Drosophila melanogaster OX=7227 GN=Actbeta PE=1 SV=2
11	AFDB:P12645	0.232	0.192	9.525E-12	472	0.213	0.165	P12645.pdb.gz	BMP3_HUMAN Bone morphogenetic protein 3 OS=Homo sapiens OX=9606 GN=BMP3 PE=1 SV=2
12	PDB:5vqfB	0.254	0.286	1.554E-10	320	0.172	0.197	5vqfB.pdb.gz
13	PDB:5ntuA	0.260	0.306	2.715E-10	308	0.175	0.208	5ntuA.pdb.gz
14	PDB:5nxsA	0.294	0.339	3.794E-10	290	0.175	0.221	5nxsA.pdb.gz
15	PDB:5ffoG	0.244	0.295	1.913E-9	297	0.148	0.182	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
16	PDB:3rjrC	0.266	0.281	6.529E-9	343	0.175	0.187	3rjrC.pdb.gz
17	PDB:7y1rB	0.252	0.292	2.744E-7	308	0.178	0.211	7y1rB.pdb.gz
18	PDB:5nxsB	0.283	0.387	2.286E-6	251	0.131	0.191	5nxsB.pdb.gz
19	PDB:1js9C	0.127	0.207	7.456E-3	189	0.079	0.153	1js9C.pdb.gz
20	PDB:1j3pA	0.103	0.165	1.042E-2	187	0.063	0.123	1j3pA.pdb.gz	Characterization of the cupin-type phosphoglucose isomerase from the hyperthermophilic archaeon Thermococcus litoralis(1).

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05111	0.0	731	366	1.000	1.000	INHA_HUMAN Inhibin alpha chain OS=Homo sapiens OX=9606 GN=INHA PE=1 SV=1
2	P17490	0.0	562	366	0.770	0.770	INHA_RAT Inhibin alpha chain OS=Rattus norvegicus OX=10116 GN=Inha PE=2 SV=1
3	Q8QGE3	5.24e-12	68.9	395	0.197	0.182	Q8QGE3_DANRE Activin beta A subunit OS=Danio rerio OX=7955 GN=actba PE=2 SV=1
4	P12645	2.30e-10	63.9	472	0.087	0.068	BMP3_HUMAN Bone morphogenetic protein 3 OS=Homo sapiens OX=9606 GN=BMP3 PE=1 SV=2
5	A0JML2	6.22e-10	62.8	452	0.117	0.095	A0JML2_DANRE Bone morphogenetic protein 3 OS=Danio rerio OX=7955 GN=zgc:153939 PE=2 SV=1
6	P58166	2.09e-09	60.8	350	0.175	0.183	INHBE_HUMAN Inhibin beta E chain OS=Homo sapiens OX=9606 GN=INHBE PE=1 SV=1
7	P49002	3.70e-09	60.5	468	0.085	0.066	BMP3_RAT Bone morphogenetic protein 3 OS=Rattus norvegicus OX=10116 GN=Bmp3 PE=2 SV=1
8	Q8BHE5	8.42e-09	59.3	468	0.085	0.066	BMP3_MOUSE Bone morphogenetic protein 3 OS=Mus musculus OX=10090 GN=Bmp3 PE=1 SV=1
9	Q7T2X6	8.51e-09	59.3	443	0.082	0.068	GDF10_XENLA Growth/differentiation factor 10 OS=Xenopus laevis OX=8355 GN=gdf10 PE=1 SV=1
10	P55108	1.00e-08	58.9	476	0.085	0.065	GDF10_RAT Growth/differentiation factor 10 OS=Rattus norvegicus OX=10116 GN=Gdf10 PE=2 SV=1
11	P97737	2.16e-08	57.8	476	0.085	0.065	GDF10_MOUSE Growth/differentiation factor 10 OS=Mus musculus OX=10090 GN=Gdf10 PE=1 SV=2
12	P55107	2.49e-08	57.8	478	0.085	0.065	GDF10_HUMAN Growth/differentiation factor 10 OS=Homo sapiens OX=9606 GN=GDF10 PE=2 SV=1
13	O93369	9.64e-08	55.8	411	0.098	0.088	O93369_DANRE Bone morphogenetic protein 2 OS=Danio rerio OX=7955 GN=BMP2b PE=2 SV=1
14	G3V6W8	1.26e-07	55.5	430	0.112	0.095	G3V6W8_RAT Bone morphogenetic protein 7 OS=Rattus norvegicus OX=10116 GN=Bmp7 PE=3 SV=1
15	P23359	1.26e-07	55.5	430	0.112	0.095	BMP7_MOUSE Bone morphogenetic protein 7 OS=Mus musculus OX=10090 GN=Bmp7 PE=1 SV=2
16	P18331	1.91e-07	55.1	424	0.077	0.066	INHBA_RAT Inhibin beta A chain OS=Rattus norvegicus OX=10116 GN=Inhba PE=2 SV=1
17	Q04998	1.95e-07	54.7	424	0.077	0.066	INHBA_MOUSE Inhibin beta A chain OS=Mus musculus OX=10090 GN=Inhba PE=1 SV=1
18	A4D1W7	1.97e-07	54.7	426	0.077	0.066	A4D1W7_HUMAN Inhibin beta A chain OS=Homo sapiens OX=9606 GN=INHBA PE=1 SV=1
19	P08476	1.97e-07	54.7	426	0.077	0.066	INHBA_HUMAN Inhibin beta A chain OS=Homo sapiens OX=9606 GN=INHBA PE=1 SV=2
20	P07995	2.10e-07	54.7	425	0.077	0.066	INHBA_BOVIN Inhibin beta A chain OS=Bos taurus OX=9913 GN=INHBA PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00019 TGF_beta	9.8e-11	53.8	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000243786

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000416606	0.947	Follitropin subunit beta
2	9606.ENSP00000241416	0.939	Activin receptor type-2A
3	9606.ENSP00000340361	0.935	Activin receptor type-2B
4	9606.ENSP00000482232	0.902	Glycoprotein hormones, alpha polypeptide
5	9606.ENSP00000212355	0.900	Transforming growth factor beta receptor type 3
6	9606.ENSP00000242208	0.858	Inhibin beta A chain
7	9606.ENSP00000295228	0.802	Inhibin beta B chain
8	9606.ENSP00000308716	0.799	Inhibin beta C chain
9	9606.ENSP00000256759	0.792	Follistatin
10	9606.ENSP00000367942	0.751	Growth/differentiation factor 9
11	9606.ENSP00000295463	0.736	Alkaline phosphatase, intestinal
12	9606.ENSP00000384708	0.713	Follicle-stimulating hormone receptor
13	9606.ENSP00000221496	0.710	Muellerian-inhibiting factor
14	9606.ENSP00000252677	0.705	Bone morphogenetic protein 15
15	9606.ENSP00000266646	0.676	Inhibin beta E chain
16	9606.ENSP00000294954	0.670	Lutropin-choriogonadotropic hormone receptor
17	9606.ENSP00000351327	0.659	A-kinase anchor protein 4
18	9606.ENSP00000316842	0.627	Homeobox protein SIX5
19	9606.ENSP00000370542	0.579	Syndecan-1
20	9606.ENSP00000379683	0.578	Aromatase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	0.999	protein-containing complex binding
GO:0005179	0.997	hormone activity
GO:0008083	0.996	growth factor activity
GO:0005125	0.995	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.980	cellular process
GO:0032501	0.975	multicellular organismal process
GO:0032502	0.971	developmental process
GO:0048856	0.960	anatomical structure development
GO:0048518	0.941	positive regulation of biological process
GO:0007275	0.940	multicellular organism development
GO:0044060	0.926	regulation of endocrine process
GO:0010817	0.918	regulation of hormone levels
GO:0048522	0.912	positive regulation of cellular process
GO:0007548	0.911	sex differentiation
GO:0048523	0.892	negative regulation of cellular process
GO:0019222	0.885	regulation of metabolic process
GO:0048731	0.882	system development
GO:0051046	0.872	regulation of secretion
GO:0060255	0.871	regulation of macromolecule metabolic process
GO:0023052	0.863	signaling
GO:0007154	0.860	cell communication
GO:0046883	0.858	regulation of hormone secretion
GO:0050896	0.853	response to stimulus
GO:0008585	0.837	female gonad development
GO:0010468	0.829	regulation of gene expression
GO:0051716	0.783	cellular response to stimulus
GO:0007165	0.769	signal transduction
GO:0050793	0.705	regulation of developmental process
GO:0071704	0.682	organic substance metabolic process
GO:0044238	0.677	primary metabolic process
GO:0031323	0.669	regulation of cellular metabolic process
GO:0051240	0.612	positive regulation of multicellular organismal process
GO:0048869	0.566	cellular developmental process
GO:0030154	0.561	cell differentiation
GO:0044237	0.486	cellular metabolic process
GO:0051241	0.401	negative regulation of multicellular organismal process
GO:0006807	0.375	nitrogen compound metabolic process
GO:2000026	0.372	regulation of multicellular organismal development
GO:0023056	0.370	positive regulation of signaling
GO:0010647	0.370	positive regulation of cell communication
GO:0045595	0.353	regulation of cell differentiation
GO:0007166	0.344	cell surface receptor signaling pathway
GO:0043170	0.335	macromolecule metabolic process
GO:0048583	0.322	regulation of response to stimulus
GO:0009893	0.319	positive regulation of metabolic process
GO:0001541	0.305	ovarian follicle development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0032991	0.999	protein-containing complex
GO:0005615	0.990	extracellular space
GO:0016020	0.955	membrane
GO:0071944	0.938	cell periphery
GO:0005886	0.914	plasma membrane
GO:0005622	0.771	intracellular anatomical structure
GO:0043226	0.764	organelle
GO:0043227	0.752	membrane-bounded organelle
GO:0043512	0.668	inhibin A complex
GO:0098797	0.633	plasma membrane protein complex
GO:0043231	0.597	intracellular membrane-bounded organelle
GO:0034673	0.398	inhibin-betaglycan-ActRII complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]