StarFunc result for job id P05113

User Input

>input (134 residues)
MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNH
QLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQ
EFLGVMNTEWIIES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05113	1.000	1.000	1.326E-20	134	1.000	1.000	P05113.pdb.gz	IL5_HUMAN Interleukin-5 OS=Homo sapiens OX=9606 GN=IL5 PE=1 SV=1
2	PDB:3va2B	0.794	0.972	2.065E-15	109	0.813	1.000	3va2B.pdb.gz
3	AFDB:P04401	0.913	0.919	8.095E-14	133	0.694	0.699	P04401.pdb.gz	IL5_MOUSE Interleukin-5 OS=Mus musculus OX=10090 GN=Il5 PE=1 SV=1
4	PDB:3b5kB	0.762	0.957	3.065E-11	106	0.604	0.764	3b5kB.pdb.gz
5	PDB:7enav	0.170	0.170	1.774	134	0.119	0.119	7enav.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
6	AFDB:A0A669KB22	0.241	0.144	2.190	251	0.112	0.060	A0A669KB22.pdb.gz	A0A669KB22_HUMAN Spectrin repeat containing nuclear envelope protein 2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=1
7	PDB:8ap7O	0.153	0.183	2.443	96	0.142	0.198	8ap7O.pdb.gz	An ancestral interaction module promotes oligomerization in divergent mitochondrial ATP synthases.
8	AFDB:Q9V439	0.274	0.261	2.489	143	0.134	0.126	Q9V439.pdb.gz	MED22_DROME Mediator of RNA polymerase II transcription subunit 22 OS=Drosophila melanogaster OX=7227 GN=MED22 PE=1 SV=1
9	AFDB:L0R819	0.203	0.264	2.654	96	0.090	0.125	L0R819.pdb.gz	ASURF_HUMAN ASNSD1 upstream open reading frame protein OS=Homo sapiens OX=9606 GN=ASDURF PE=1 SV=1
10	AFDB:P32788	0.193	0.107	2.654	280	0.172	0.082	P32788.pdb.gz	YBB0_YEAST Uncharacterized protein YBL010C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YBL010C PE=1 SV=1
11	AFDB:A8MX29	0.265	0.132	3.016	333	0.172	0.069	A8MX29.pdb.gz	A8MX29_HUMAN Kinesin light chain OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1
12	PDB:1lqsL	0.209	0.199	3.157	142	0.097	0.092	1lqsL.pdb.gz
13	AFDB:Q15528	0.225	0.164	3.428	200	0.142	0.095	Q15528.pdb.gz	MED22_HUMAN Mediator of RNA polymerase II transcription subunit 22 OS=Homo sapiens OX=9606 GN=MED22 PE=1 SV=2
14	AFDB:O46199	0.218	0.236	3.655	120	0.104	0.117	O46199.pdb.gz	A53E_DROME Accessory gland protein Acp53Ea OS=Drosophila melanogaster OX=7227 GN=Acp53Ea PE=2 SV=1
15	AFDB:Q4FKA6	0.161	0.050	3.655	628	0.112	0.024	Q4FKA6.pdb.gz	Q4FKA6_TRYB2 Translation initiation factor eIF2B delta subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.1400 PE=3 SV=1
16	PDB:3duhC	0.303	0.297	4.348	137	0.134	0.131	3duhC.pdb.gz
17	PDB:4i91A	0.233	0.087	4.636	465	0.164	0.047	4i91A.pdb.gz	Structural and Thermodynamic Basis of (+)-alpha-Pinene Binding to Human Cytochrome P450 2B6.
18	PDB:4c3hA	0.152	0.022	5.269	1523	0.082	0.007	4c3hA.pdb.gz	Crystal Structure of the 14-Subunit RNA Polymerase I
19	PDB:2ilkA	0.364	0.327	5.617	155	0.134	0.116	2ilkA.pdb.gz	Crystal structure of human interleukin-10 at 1.6 A resolution and a model of a complex with its soluble receptor.
20	PDB:6pzqA	0.171	0.151	5.617	157	0.127	0.108	6pzqA.pdb.gz	Structure of the Human Respiratory Syncytial Virus M2-1 Protein in Complex with a Short Positive-Sense Gene-End RNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05113	1.29e-96	275	134	1.000	1.000	IL5_HUMAN Interleukin-5 OS=Homo sapiens OX=9606 GN=IL5 PE=1 SV=1
2	P04401	8.80e-64	192	133	0.694	0.699	IL5_MOUSE Interleukin-5 OS=Mus musculus OX=10090 GN=Il5 PE=1 SV=1
3	Q08125	2.84e-63	191	132	0.694	0.705	IL5_RAT Interleukin-5 OS=Rattus norvegicus OX=10116 GN=Il5 PE=3 SV=1
4	Q8R4T9	0.12	33.9	930	0.149	0.022	UT2_MOUSE Urea transporter 2 OS=Mus musculus OX=10090 GN=Slc14a2 PE=1 SV=2
5	Q62668	2.3	30.4	929	0.142	0.020	UT2_RAT Urea transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc14a2 PE=1 SV=2
6	P54277	3.1	30.0	932	0.157	0.023	PMS1_HUMAN PMS1 protein homolog 1 OS=Homo sapiens OX=9606 GN=PMS1 PE=1 SV=1
7	Q3S3D7	6.2	28.9	1441	0.119	0.011	Q3S3D7_XENBO Neogenin variant 1 OS=Xenopus borealis OX=8354 PE=2 SV=1
8	Q3MIB4	9.4	28.5	852	0.119	0.019	LONP2_RAT Lon protease homolog 2, peroxisomal OS=Rattus norvegicus OX=10116 GN=Lonp2 PE=1 SV=2
9	Q584V0	9.7	28.5	477	0.164	0.046	Q584V0_TRYB2 histidine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.280 PE=1 SV=1
10	Q9DBN5	9.8	28.5	852	0.119	0.019	LONP2_MOUSE Lon protease homolog 2, peroxisomal OS=Mus musculus OX=10090 GN=Lonp2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19499 DUF6034	4.2e+02	11.3	Family of unknown function (DUF6034)
2	PF02025 IL5	1.8e-60	213.5	Interleukin 5

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000231454

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000412209	0.999	Interleukin-5 receptor subunit alpha
2	9606.ENSP00000384053	0.989	Cytokine receptor common subunit beta
3	9606.ENSP00000368632	0.980	Trans-acting T-cell-specific transcription factor GATA-3
4	9606.ENSP00000302234	0.960	Eotaxin
5	9606.ENSP00000293328	0.958	Signal transducer and activator of transcription 5B
6	9606.ENSP00000341208	0.958	Signal transducer and activator of transcription 5A
7	9606.ENSP00000226730	0.954	Interleukin-2
8	9606.ENSP00000296871	0.954	Granulocyte-macrophage colony-stimulating factor
9	9606.ENSP00000371067	0.949	Tyrosine-protein kinase JAK2
10	9606.ENSP00000428924	0.949	Tyrosine-protein kinase Lyn
11	9606.ENSP00000260130	0.946	Syntenin-1
12	9606.ENSP00000296870	0.932	Interleukin-3
13	9606.ENSP00000231449	0.923	Interleukin-4
14	9606.ENSP00000340944	0.922	Tyrosine-protein phosphatase non-receptor type 11
15	9606.ENSP00000304915	0.921	Interleukin-13
16	9606.ENSP00000428056	0.916	Phosphatidylinositol 3-kinase regulatory subunit alpha
17	9606.ENSP00000376345	0.915	Growth factor receptor-bound protein 2
18	9606.ENSP00000412237	0.915	Interleukin-10
19	9606.ENSP00000263967	0.905	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
20	9606.ENSP00000309591	0.900	cAMP-dependent protein kinase catalytic subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030545	1.000	signaling receptor regulator activity
GO:0070851	1.000	growth factor receptor binding
GO:0005126	1.000	cytokine receptor binding
GO:0140677	0.999	molecular function activator activity
GO:0048018	0.986	receptor ligand activity
GO:0005125	0.956	cytokine activity
GO:0005137	0.943	interleukin-5 receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0048522	0.981	positive regulation of cellular process
GO:0009987	0.956	cellular process
GO:0002682	0.956	regulation of immune system process
GO:0006950	0.928	response to stress
GO:0006954	0.908	inflammatory response
GO:0019222	0.881	regulation of metabolic process
GO:0051239	0.872	regulation of multicellular organismal process
GO:0051716	0.868	cellular response to stimulus
GO:0060255	0.855	regulation of macromolecule metabolic process
GO:0002684	0.822	positive regulation of immune system process
GO:0009893	0.788	positive regulation of metabolic process
GO:0007154	0.786	cell communication
GO:0023052	0.758	signaling
GO:0044087	0.754	regulation of cellular component biogenesis
GO:0007165	0.752	signal transduction
GO:0048583	0.738	regulation of response to stimulus
GO:0042221	0.724	response to chemical
GO:0010604	0.716	positive regulation of macromolecule metabolic process
GO:0051130	0.707	positive regulation of cellular component organization
GO:0044089	0.633	positive regulation of cellular component biogenesis
GO:0033043	0.557	regulation of organelle organization
GO:0002376	0.556	immune system process
GO:0051240	0.552	positive regulation of multicellular organismal process
GO:1902115	0.549	regulation of organelle assembly
GO:0031323	0.546	regulation of cellular metabolic process
GO:0010468	0.528	regulation of gene expression
GO:0051171	0.524	regulation of nitrogen compound metabolic process
GO:0080090	0.515	regulation of primary metabolic process
GO:0051173	0.487	positive regulation of nitrogen compound metabolic process
GO:0031325	0.485	positive regulation of cellular metabolic process
GO:0043254	0.484	regulation of protein-containing complex assembly
GO:0042127	0.476	regulation of cell population proliferation
GO:0010033	0.472	response to organic substance
GO:0023051	0.467	regulation of signaling
GO:0010646	0.467	regulation of cell communication
GO:0009966	0.451	regulation of signal transduction
GO:0048584	0.437	positive regulation of response to stimulus
GO:0070887	0.422	cellular response to chemical stimulus
GO:0032501	0.415	multicellular organismal process
GO:0006955	0.413	immune response
GO:0071310	0.400	cellular response to organic substance
GO:0007166	0.382	cell surface receptor signaling pathway
GO:0048519	0.380	negative regulation of biological process
GO:0048523	0.362	negative regulation of cellular process
GO:0071704	0.360	organic substance metabolic process
GO:0008284	0.358	positive regulation of cell population proliferation
GO:0010628	0.352	positive regulation of gene expression
GO:0042325	0.328	regulation of phosphorylation
GO:0009889	0.327	regulation of biosynthetic process
GO:0051246	0.324	regulation of protein metabolic process
GO:0031326	0.323	regulation of cellular biosynthetic process
GO:0010556	0.317	regulation of macromolecule biosynthetic process
GO:0019219	0.317	regulation of nucleobase-containing compound metabolic process
GO:0051247	0.309	positive regulation of protein metabolic process
GO:0031399	0.307	regulation of protein modification process
GO:0031334	0.302	positive regulation of protein-containing complex assembly
GO:0051252	0.300	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005622	0.552	intracellular anatomical structure
GO:0005886	0.396	plasma membrane
GO:0043231	0.351	intracellular membrane-bounded organelle
GO:0005737	0.348	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]