StarFunc result for job id P05120

User Input

>input (415 residues)
MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQF
NEVGANAVTPMTPENFTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGN
YLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAEEARKKINSWVKTQTKGK
IPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREK
LNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKM
AEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMV
DVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05120	1.000	1.000	2.105E-88	415	1.000	1.000	P05120.pdb.gz	PAI2_HUMAN Plasminogen activator inhibitor 2 OS=Homo sapiens OX=9606 GN=SERPINB2 PE=1 SV=2
2	AFDB:P29524	0.956	0.954	8.386E-73	416	0.728	0.726	P29524.pdb.gz	PAI2_RAT Plasminogen activator inhibitor 2 type A OS=Rattus norvegicus OX=10116 GN=Serpinb2 PE=2 SV=1
3	AFDB:P12388	0.937	0.937	2.030E-71	415	0.759	0.759	P12388.pdb.gz	PAI2_MOUSE Plasminogen activator inhibitor 2, macrophage OS=Mus musculus OX=10090 GN=Serpinb2 PE=1 SV=1
4	PDB:2arqA	0.821	0.942	7.509E-63	360	0.860	0.992	2arqA.pdb.gz	Plasminogen activator inhibitor-2 is highly tolerant to P8 residue substitution--implications for serpin mechanistic model and prediction of nsSNP activities
5	AFDB:Q8K3K4	0.905	0.945	2.467E-54	397	0.434	0.453	Q8K3K4.pdb.gz	SPB10_RAT Serpin B10 OS=Rattus norvegicus OX=10116 GN=Serpinb10 PE=2 SV=1
6	AFDB:P30740	0.870	0.951	2.936E-54	379	0.458	0.501	P30740.pdb.gz	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1
7	AFDB:P48595	0.874	0.912	1.695E-52	397	0.451	0.471	P48595.pdb.gz	SPB10_HUMAN Serpin B10 OS=Homo sapiens OX=9606 GN=SERPINB10 PE=1 SV=1
8	AFDB:P35237	0.864	0.951	3.070E-51	376	0.458	0.505	P35237.pdb.gz	SPB6_HUMAN Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3
9	AFDB:Q9D154	0.861	0.941	4.880E-51	379	0.439	0.480	Q9D154.pdb.gz	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
10	AFDB:O73790	0.897	0.908	8.220E-51	410	0.407	0.412	O73790.pdb.gz	SPB10_CHICK Heterochromatin-associated protein MENT OS=Gallus gallus OX=9031 GN=SERPINB10 PE=1 SV=1
11	AFDB:Q60854	0.865	0.948	8.220E-51	378	0.431	0.474	Q60854.pdb.gz	SPB6_MOUSE Serpin B6 OS=Mus musculus OX=10090 GN=Serpinb6 PE=1 SV=1
12	PDB:4ga7A	0.842	0.946	7.659E-50	369	0.443	0.499	4ga7A.pdb.gz
13	PDB:2h4rA	0.841	0.938	7.348E-45	371	0.395	0.442	2h4rA.pdb.gz
14	PDB:2zv6B	0.831	0.927	1.186E-43	371	0.405	0.453	2zv6B.pdb.gz
15	PDB:1xqgA	0.809	0.885	7.800E-41	378	0.316	0.347	1xqgA.pdb.gz
16	PDB:2ol2A	0.779	0.893	1.277E-38	360	0.282	0.325	2ol2A.pdb.gz
17	PDB:1yxaA	0.805	0.894	4.842E-38	372	0.272	0.304	1yxaA.pdb.gz
18	PDB:1jmoA	0.800	0.779	1.224E-37	427	0.299	0.290	1jmoA.pdb.gz
19	PDB:3f1sA	0.809	0.870	5.848E-37	385	0.260	0.281	3f1sA.pdb.gz
20	PDB:4dteA	0.787	0.869	6.196E-37	374	0.277	0.307	4dteA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05120	0.0	868	415	1.000	1.000	PAI2_HUMAN Plasminogen activator inhibitor 2 OS=Homo sapiens OX=9606 GN=SERPINB2 PE=1 SV=2
2	P12388	0.0	671	415	0.759	0.759	PAI2_MOUSE Plasminogen activator inhibitor 2, macrophage OS=Mus musculus OX=10090 GN=Serpinb2 PE=1 SV=1
3	P29524	0.0	649	416	0.728	0.726	PAI2_RAT Plasminogen activator inhibitor 2 type A OS=Rattus norvegicus OX=10116 GN=Serpinb2 PE=2 SV=1
4	P48595	7.37e-125	369	397	0.455	0.476	SPB10_HUMAN Serpin B10 OS=Homo sapiens OX=9606 GN=SERPINB10 PE=1 SV=1
5	A0A024QZT4	3.45e-117	348	376	0.419	0.463	A0A024QZT4_HUMAN Testicular tissue protein Li 180 OS=Homo sapiens OX=9606 PE=2 SV=1
6	P50453	3.45e-117	348	376	0.419	0.463	SPB9_HUMAN Serpin B9 OS=Homo sapiens OX=9606 GN=SERPINB9 PE=1 SV=1
7	Q8K3K4	2.59e-116	347	397	0.441	0.461	SPB10_RAT Serpin B10 OS=Rattus norvegicus OX=10116 GN=Serpinb10 PE=2 SV=1
8	P30740	9.22e-115	342	379	0.458	0.501	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1
9	V9HWH1	9.22e-115	342	379	0.458	0.501	V9HWH1_HUMAN Epididymis luminal protein 57 OS=Homo sapiens OX=9606 GN=HEL57 PE=2 SV=1
10	P35237	2.22e-111	333	376	0.455	0.503	SPB6_HUMAN Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3
11	O73790	4.03e-111	334	410	0.407	0.412	SPB10_CHICK Heterochromatin-associated protein MENT OS=Gallus gallus OX=9031 GN=SERPINB10 PE=1 SV=1
12	Q8VHP7	1.32e-110	332	382	0.441	0.479	ILEUB_MOUSE Leukocyte elastase inhibitor B OS=Mus musculus OX=10090 GN=Serpinb1b PE=1 SV=1
13	Q9D154	9.73e-110	329	379	0.434	0.475	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
14	P50452	3.47e-109	328	374	0.436	0.484	SPB8_HUMAN Serpin B8 OS=Homo sapiens OX=9606 GN=SERPINB8 PE=1 SV=2
15	Q60854	2.22e-104	315	378	0.439	0.481	SPB6_MOUSE Serpin B6 OS=Mus musculus OX=10090 GN=Serpinb6 PE=1 SV=1
16	Q9D1Q5	9.47e-103	311	387	0.400	0.429	Q9D1Q5_MOUSE Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=1 SV=1
17	Q5SV42	2.13e-102	310	375	0.412	0.456	ILEUC_MOUSE Leukocyte elastase inhibitor C OS=Mus musculus OX=10090 GN=Serpinb1c PE=1 SV=1
18	Q6UKZ2	1.42e-101	308	387	0.393	0.421	Q6UKZ2_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B (Ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
19	P01014	6.33e-101	307	388	0.395	0.423	OVALY_CHICK Ovalbumin-related protein Y OS=Gallus gallus OX=9031 GN=SERPINB14B PE=1 SV=1
20	Q8BHL1	6.62e-101	307	387	0.393	0.421	Q8BHL1_MOUSE Squamous cell carcinoma antigen 2 related protein 1 OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06202 GDE_C	4.2e+02	11.2	Amylo-alpha-1,6-glucosidase
2	PF00079 Serpin	2.3e-126	433.7	Serpin (serine protease inhibitor)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000401645

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361850	0.994	Urokinase-type plasminogen activator
2	9606.ENSP00000308938	0.987	Plasminogen
3	9606.ENSP00000220809	0.972	Tissue-type plasminogen activator
4	9606.ENSP00000339328	0.968	Urokinase plasminogen activator surface receptor
5	9606.ENSP00000381072	0.917	Serpin B8
6	9606.ENSP00000484343	0.909	Serpin B6
7	9606.ENSP00000376134	0.902	Signal transducer and activator of transcription 4
8	9606.ENSP00000223095	0.872	Plasminogen activator inhibitor 1
9	9606.ENSP00000262193	0.842	Proteasome subunit beta type-1
10	9606.ENSP00000234071	0.841	Vitamin K-dependent protein C
11	9606.ENSP00000226218	0.809	Vitronectin
12	9606.ENSP00000234701	0.764	Calcium-activated chloride channel regulator 1
13	9606.ENSP00000369071	0.759	Periostin
14	9606.ENSP00000304915	0.728	Interleukin-13
15	9606.ENSP00000454071	0.728	Low-density lipoprotein receptor
16	9606.ENSP00000444810	0.720	Peptidyl-prolyl cis-trans isomerase FKBP5
17	9606.ENSP00000001008	0.713	Peptidyl-prolyl cis-trans isomerase FKBP4
18	9606.ENSP00000231449	0.710	Interleukin-4
19	9606.ENSP00000231454	0.697	Interleukin-5
20	9606.ENSP00000229135	0.694	Interferon gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004867	1.000	serine-type endopeptidase inhibitor activity
GO:0005488	0.997	binding
GO:0005515	0.987	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0050789	0.982	regulation of biological process
GO:0048519	0.917	negative regulation of biological process
GO:0050818	0.917	regulation of coagulation
GO:0050794	0.915	regulation of cellular process
GO:1903034	0.914	regulation of response to wounding
GO:1900046	0.914	regulation of hemostasis
GO:0050896	0.891	response to stimulus
GO:0061041	0.871	regulation of wound healing
GO:1903035	0.842	negative regulation of response to wounding
GO:1900047	0.817	negative regulation of hemostasis
GO:0051241	0.796	negative regulation of multicellular organismal process
GO:0032101	0.782	regulation of response to external stimulus
GO:0030193	0.720	regulation of blood coagulation
GO:0009987	0.668	cellular process
GO:0050819	0.561	negative regulation of coagulation
GO:0048523	0.539	negative regulation of cellular process
GO:0019222	0.522	regulation of metabolic process
GO:0060255	0.490	regulation of macromolecule metabolic process
GO:0032102	0.391	negative regulation of response to external stimulus
GO:0048518	0.376	positive regulation of biological process
GO:0006950	0.372	response to stress
GO:0061045	0.325	negative regulation of wound healing
GO:0030195	0.301	negative regulation of blood coagulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0071944	0.996	cell periphery
GO:0016020	0.996	membrane
GO:0005886	0.988	plasma membrane
GO:0005622	0.945	intracellular anatomical structure
GO:0005737	0.885	cytoplasm
GO:0005615	0.847	extracellular space
GO:0043226	0.796	organelle
GO:0043227	0.756	membrane-bounded organelle
GO:0043231	0.710	intracellular membrane-bounded organelle
GO:0031982	0.479	vesicle
GO:0012505	0.457	endomembrane system
GO:0043233	0.432	organelle lumen
GO:0070013	0.421	intracellular organelle lumen
GO:0005829	0.380	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]