StarFunc result for job id P05141

User Input

>input (298 residues)
MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVS
VQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05141	1.000	1.000	3.180E-41	298	1.000	1.000	P05141.pdb.gz	ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens OX=9606 GN=SLC25A5 PE=1 SV=7
2	AFDB:A0A0S2Z3H3	0.991	0.991	6.678E-36	298	0.889	0.889	A0A0S2Z3H3.pdb.gz	A0A0S2Z3H3_HUMAN ADP/ATP translocase (Fragment) OS=Homo sapiens OX=9606 GN=SLC25A4 PE=2 SV=1
3	AFDB:Q26365	0.981	0.937	2.606E-35	312	0.799	0.763	Q26365.pdb.gz	ADT_DROME ADP,ATP carrier protein OS=Drosophila melanogaster OX=7227 GN=sesB PE=2 SV=4
4	PDB:2c3eA	0.952	0.968	1.777E-32	293	0.876	0.891	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
5	AFDB:Q9H0C2	0.966	0.914	5.435E-32	315	0.708	0.670	Q9H0C2.pdb.gz	ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens OX=9606 GN=SLC25A31 PE=1 SV=1
6	AFDB:Q3V132	0.961	0.895	2.030E-31	320	0.695	0.647	Q3V132.pdb.gz	ADT4_MOUSE ADP/ATP translocase 4 OS=Mus musculus OX=10090 GN=Slc25a31 PE=1 SV=1
7	AFDB:G5EFU2	0.964	0.919	1.993E-30	313	0.695	0.661	G5EFU2.pdb.gz	G5EFU2_CAEEL ADP/ATP translocase OS=Caenorhabditis elegans OX=6239 GN=ant-1.4 PE=1 SV=1
8	AFDB:O01813	0.953	0.947	3.376E-30	300	0.654	0.650	O01813.pdb.gz	O01813_CAEEL ADP/ATP translocase OS=Caenorhabditis elegans OX=6239 GN=ant-1.2 PE=1 SV=1
9	AFDB:O97470	0.924	0.892	1.269E-27	309	0.668	0.644	O97470.pdb.gz	ADT_DICDI Mitochondrial substrate carrier family protein ancA OS=Dictyostelium discoideum OX=44689 GN=ancA PE=1 SV=1
10	AFDB:Q5A516	0.914	0.905	6.659E-24	301	0.550	0.545	Q5A516.pdb.gz	Q5A516_CANAL ADP/ATP translocase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PET9 PE=3 SV=1
11	AFDB:P04710	0.909	0.878	1.534E-23	309	0.523	0.505	P04710.pdb.gz	ADT1_YEAST ADP,ATP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AAC1 PE=1 SV=1
12	PDB:4c9qB	0.884	0.908	8.185E-22	290	0.527	0.541	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
13	PDB:6gciA	0.570	0.580	8.955E-15	292	0.527	0.538	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:2lckA	0.533	0.534	9.931E-4	297	0.232	0.232	2lckA.pdb.gz
15	PDB:7ehlA	0.156	0.105	6.055E-1	563	0.151	0.080	7ehlA.pdb.gz	Cryo-EM structure of human ABCB8 transporter in nucleotide binding state.
16	PDB:7d3sR	0.153	0.158	9.394E-1	266	0.121	0.135	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
17	PDB:7bc7A	0.154	0.123	1.170	432	0.168	0.116	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
18	PDB:1is2A	0.217	0.130	1.223	637	0.154	0.072	1is2A.pdb.gz	Three-dimensional structure of the flavoenzyme acyl-CoA oxidase-II from rat liver, the peroxisomal counterpart of mitochondrial acyl-CoA dehydrogenase.
19	PDB:3d31C	0.169	0.190	1.223	248	0.104	0.125	3d31C.pdb.gz	Structural basis of trans-inhibition in a molybdate/tungstate ABC transporter.
20	PDB:1fx8A	0.207	0.233	1.335	254	0.134	0.157	1fx8A.pdb.gz	Structure of a glycerol-conducting channel and the basis for its selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z3H3	0.0	556	298	0.889	0.889	A0A0S2Z3H3_HUMAN ADP/ATP translocase (Fragment) OS=Homo sapiens OX=9606 GN=SLC25A4 PE=2 SV=1
2	P02722	0.0	559	298	0.893	0.893	ADT1_BOVIN ADP/ATP translocase 1 OS=Bos taurus OX=9913 GN=SLC25A4 PE=1 SV=3
3	P05141	0.0	609	298	1.000	1.000	ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens OX=9606 GN=SLC25A5 PE=1 SV=7
4	P12235	0.0	556	298	0.889	0.889	ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens OX=9606 GN=SLC25A4 PE=1 SV=4
5	P12236	0.0	573	298	0.919	0.919	ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4
6	P48962	0.0	558	298	0.889	0.889	ADT1_MOUSE ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4
7	P51881	0.0	600	298	0.983	0.983	ADT2_MOUSE ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3
8	Q05962	0.0	558	298	0.889	0.889	ADT1_RAT ADP/ATP translocase 1 OS=Rattus norvegicus OX=10116 GN=Slc25a4 PE=1 SV=3
9	Q09073	0.0	602	298	0.987	0.987	ADT2_RAT ADP/ATP translocase 2 OS=Rattus norvegicus OX=10116 GN=Slc25a5 PE=1 SV=3
10	Q5ZMJ6	0.0	560	298	0.889	0.889	Q5ZMJ6_CHICK ADP/ATP translocase OS=Gallus gallus OX=9031 GN=SLC25A4 PE=1 SV=1
11	Q6I9V5	0.0	573	298	0.919	0.919	Q6I9V5_HUMAN ADP/ATP translocase OS=Homo sapiens OX=9606 GN=SLC25A6 PE=2 SV=1
12	Q26365	7.41e-178	495	312	0.799	0.763	ADT_DROME ADP,ATP carrier protein OS=Drosophila melanogaster OX=7227 GN=sesB PE=2 SV=4
13	Q3V132	6.06e-156	439	320	0.698	0.650	ADT4_MOUSE ADP/ATP translocase 4 OS=Mus musculus OX=10090 GN=Slc25a31 PE=1 SV=1
14	Q9H0C2	1.57e-155	438	315	0.705	0.667	ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens OX=9606 GN=SLC25A31 PE=1 SV=1
15	O45865	3.18e-144	409	300	0.685	0.680	O45865_CAEEL ADP/ATP translocase OS=Caenorhabditis elegans OX=6239 GN=ant-1.1 PE=1 SV=1
16	G5EFU2	3.53e-143	407	313	0.695	0.661	G5EFU2_CAEEL ADP/ATP translocase OS=Caenorhabditis elegans OX=6239 GN=ant-1.4 PE=1 SV=1
17	O01813	4.93e-137	391	300	0.658	0.653	O01813_CAEEL ADP/ATP translocase OS=Caenorhabditis elegans OX=6239 GN=ant-1.2 PE=1 SV=1
18	O97470	1.30e-135	388	309	0.671	0.647	ADT_DICDI Mitochondrial substrate carrier family protein ancA OS=Dictyostelium discoideum OX=44689 GN=ancA PE=1 SV=1
19	Q59EP7	7.39e-107	313	261	0.493	0.563	Q59EP7_HUMAN ADP/ATP translocase (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
20	Q5A516	3.17e-102	303	301	0.550	0.545	Q5A516_CANAL ADP/ATP translocase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PET9 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15993 Fuseless	1.4e+02	13.1	Fuseless
2	PF00153 Mito_carr	1.8e-64	225.0	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360671

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000412698	0.983	MMS19 nucleotide excision repair protein homolog
2	9606.ENSP00000281456	0.971	ADP/ATP translocase 1
3	9606.ENSP00000418287	0.968	Probable cytosolic iron-sulfur protein assembly protein CIAO1
4	9606.ENSP00000225174	0.961	Peptidyl-prolyl cis-trans isomerase F, mitochondrial
5	9606.ENSP00000361635	0.960	Voltage-dependent anion-selective channel protein 2
6	9606.ENSP00000387471	0.958	Mitotic spindle-associated MMXD complex subunit MIP18
7	9606.ENSP00000262030	0.945	ATP synthase subunit beta, mitochondrial
8	9606.ENSP00000265333	0.945	Voltage-dependent anion-selective channel protein 1
9	9606.ENSP00000381736	0.945	ATP synthase subunit alpha, mitochondrial
10	9606.ENSP00000328551	0.938	Ras-related protein Rab-28
11	9606.ENSP00000307786	0.936	Cytochrome c
12	9606.ENSP00000428845	0.917	Voltage-dependent anion-selective channel protein 3
13	9606.ENSP00000370808	0.905	ADP/ATP translocase 3
14	9606.ENSP00000375809	0.902	TFIIH basal transcription factor complex helicase XPD subunit
15	9606.ENSP00000202967	0.901	NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
16	9606.ENSP00000379563	0.899	Translocator protein
17	9606.ENSP00000303754	0.857	Peptidyl-prolyl cis-trans isomerase D
18	9606.ENSP00000306124	0.829	Protein kinase C epsilon type
19	9606.ENSP00000317780	0.814	Cytochrome c oxidase subunit 5A, mitochondrial
20	9606.ENSP00000479488	0.812	Prohibitin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0015215	0.995	nucleotide transmembrane transporter activity
GO:0008514	0.994	organic anion transmembrane transporter activity
GO:1901702	0.976	salt transmembrane transporter activity
GO:0000295	0.976	adenine nucleotide transmembrane transporter activity
GO:0022804	0.957	active transmembrane transporter activity
GO:0015291	0.954	secondary active transmembrane transporter activity
GO:1901505	0.747	carbohydrate derivative transmembrane transporter activity
GO:0005346	0.744	purine ribonucleotide transmembrane transporter activity
GO:0005347	0.615	ATP transmembrane transporter activity
GO:0097159	0.589	organic cyclic compound binding
GO:1901363	0.582	heterocyclic compound binding
GO:0015217	0.559	ADP transmembrane transporter activity
GO:0003676	0.543	nucleic acid binding
GO:0003723	0.473	RNA binding
GO:0015297	0.348	antiporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0015748	0.986	organophosphate ester transport
GO:0065007	0.946	biological regulation
GO:0015865	0.932	purine nucleotide transport
GO:0007005	0.879	mitochondrion organization
GO:0007006	0.867	mitochondrial membrane organization
GO:0050789	0.830	regulation of biological process
GO:0090559	0.787	regulation of membrane permeability
GO:0006839	0.705	mitochondrial transport
GO:0050794	0.702	regulation of cellular process
GO:0008152	0.635	metabolic process
GO:0044237	0.508	cellular metabolic process
GO:0048518	0.501	positive regulation of biological process
GO:0051503	0.488	adenine nucleotide transport
GO:0071704	0.442	organic substance metabolic process
GO:0019222	0.397	regulation of metabolic process
GO:0046902	0.320	regulation of mitochondrial membrane permeability
GO:0048522	0.306	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.998	membrane
GO:0005740	0.987	mitochondrial envelope
GO:0005743	0.975	mitochondrial inner membrane
GO:0032991	0.943	protein-containing complex
GO:0070013	0.917	intracellular organelle lumen
GO:0005634	0.809	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]