StarFunc result for job id P05155

User Input

>input (500 residues)
MASRLTLLTLLLLLLAGDRASSNPNATSSSSQDPESLQDRGEGKVATTVISKMLFVEPIL
EVSSLPTTNSTTNSATKITANTTDEPTTQPTTEPTTQPTIQPTQPTTQLPTDSPTQPTTG
SFCPGPVTLCSDLESHSTEAVLGDALVDFSLKLYHAFSAMKKVETNMAFSPFSIASLLTQ
VLLGAGENTKTNLESILSYPKDFTCVHQALKGFTTKGVTSVSQIFHSPDLAIRDTFVNAS
RTLYSSSPRVLSNNSDANLELINTWVAKNTNNKISRLLDSLPSDTRLVLLNAIYLSAKWK
TTFDPKKTRMEPFHFKNSVIKVPMMNSKKYPVAHFIDQTLKAKVGQLQLSHNLSLVILVP
QNLKHRLEDMEQALSPSVFKAIMEKLEMSKFQPTLLTLPRIKVTTSQDMLSIMEKLEFFD
FSYDLNLCGLTEDPDLQVSAMQHQTVLELTETGVEAAAASAISVARTLLVFEVQQPFLFV
LWDQQHKFPVFMGRVYDPRA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384MDV8	0.812	0.812	8.072E-92	500	0.998	0.998	A0A384MDV8.pdb.gz	A0A384MDV8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=1 SV=1
2	AFDB:P97290	0.784	0.778	1.433E-74	504	0.698	0.692	P97290.pdb.gz	IC1_MOUSE Plasma protease C1 inhibitor OS=Mus musculus OX=10090 GN=Serping1 PE=1 SV=3
3	AFDB:Q6P734	0.753	0.747	2.681E-74	504	0.678	0.673	Q6P734.pdb.gz	IC1_RAT Plasma protease C1 inhibitor OS=Rattus norvegicus OX=10116 GN=Serping1 PE=2 SV=1
4	AFDB:F7FHF3	0.687	0.622	1.135E-37	554	0.256	0.231	F7FHF3.pdb.gz	F7FHF3_RAT Serpin family F member 2 OS=Rattus norvegicus OX=10116 GN=Serpinf2 PE=1 SV=1
5	PDB:2r9yA	0.660	0.894	3.862E-35	365	0.204	0.279	2r9yA.pdb.gz
6	AFDB:Q80ZA3	0.663	0.787	4.016E-35	418	0.212	0.254	Q80ZA3.pdb.gz	Q80ZA3_RAT Serine (Or cysteine) peptidase inhibitor, clade F, member 1 OS=Rattus norvegicus OX=10116 GN=Serpinf1 PE=2 SV=1
7	AFDB:Q95121	0.666	0.795	2.220E-34	416	0.208	0.250	Q95121.pdb.gz	PEDF_BOVIN Pigment epithelium-derived factor OS=Bos taurus OX=9913 GN=SERPINF1 PE=1 SV=1
8	PDB:1yxaA	0.647	0.858	2.681E-34	372	0.210	0.282	1yxaA.pdb.gz
9	AFDB:Q3ZEJ6	0.682	0.824	3.124E-34	411	0.216	0.263	Q3ZEJ6.pdb.gz	SPA33_BOVIN Serpin A3-3 OS=Bos taurus OX=9913 GN=SERPINA3-3 PE=1 SV=2
10	AFDB:P36955	0.665	0.789	3.707E-34	418	0.196	0.234	P36955.pdb.gz	PEDF_HUMAN Pigment epithelium-derived factor OS=Homo sapiens OX=9606 GN=SERPINF1 PE=1 SV=4
11	PDB:1imvA	0.667	0.879	3.774E-34	375	0.196	0.261	1imvA.pdb.gz
12	AFDB:P07758	0.670	0.805	4.398E-34	413	0.206	0.249	P07758.pdb.gz	A1AT1_MOUSE Alpha-1-antitrypsin 1-1 OS=Mus musculus OX=10090 GN=Serpina1a PE=1 SV=4
13	PDB:3f1sA	0.677	0.871	6.302E-34	385	0.204	0.265	3f1sA.pdb.gz
14	AFDB:P17475	0.669	0.808	7.775E-34	411	0.202	0.246	P17475.pdb.gz	A1AT_RAT Alpha-1-antiproteinase OS=Rattus norvegicus OX=10116 GN=Serpina1 PE=1 SV=2
15	PDB:1hp7A	0.660	0.867	1.481E-33	376	0.196	0.261	1hp7A.pdb.gz	A 2.1 A resolution structure of an uncleaved alpha(1)-antitrypsin shows variability of the reactive center and other loops.
16	PDB:2h4rA	0.656	0.874	2.085E-33	371	0.204	0.275	2h4rA.pdb.gz
17	PDB:6losA	0.653	0.873	3.107E-33	369	0.196	0.266	6losA.pdb.gz	Spatiotemporal regulation of PEDF signaling by type I collagen remodeling.
18	PDB:2ol2A	0.642	0.881	6.518E-33	360	0.204	0.283	2ol2A.pdb.gz
19	PDB:1jmoA	0.655	0.761	2.500E-31	427	0.178	0.208	1jmoA.pdb.gz
20	PDB:4x30A	0.639	0.847	2.647E-31	372	0.186	0.250	4x30A.pdb.gz	Crystal structure of human Thyroxine-binding globulin complexed with thyroine at 1.55 Angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384MDV8	0.0	1018	500	0.998	0.998	A0A384MDV8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=1 SV=1
2	P05155	0.0	1020	500	1.000	1.000	IC1_HUMAN Plasma protease C1 inhibitor OS=Homo sapiens OX=9606 GN=SERPING1 PE=1 SV=2
3	P97290	0.0	658	504	0.702	0.696	IC1_MOUSE Plasma protease C1 inhibitor OS=Mus musculus OX=10090 GN=Serping1 PE=1 SV=3
4	Q6P734	0.0	655	504	0.696	0.690	IC1_RAT Plasma protease C1 inhibitor OS=Rattus norvegicus OX=10116 GN=Serping1 PE=2 SV=1
5	P08697	7.21e-46	169	491	0.220	0.224	A2AP_HUMAN Alpha-2-antiplasmin OS=Homo sapiens OX=9606 GN=SERPINF2 PE=1 SV=3
6	Q61247	5.58e-43	161	491	0.210	0.214	A2AP_MOUSE Alpha-2-antiplasmin OS=Mus musculus OX=10090 GN=Serpinf2 PE=1 SV=1
7	Q95121	3.52e-42	157	416	0.200	0.240	PEDF_BOVIN Pigment epithelium-derived factor OS=Bos taurus OX=9913 GN=SERPINF1 PE=1 SV=1
8	Q68FT8	7.65e-42	158	491	0.212	0.216	Q68FT8_RAT RCG33981, isoform CRA_a OS=Rattus norvegicus OX=10116 GN=Serpinf2 PE=2 SV=1
9	F7FHF3	2.63e-41	157	554	0.212	0.191	F7FHF3_RAT Serpin family F member 2 OS=Rattus norvegicus OX=10116 GN=Serpinf2 PE=1 SV=1
10	A0A8I6AQI7	2.88e-41	157	561	0.212	0.189	A0A8I6AQI7_RAT Serpin family F member 2 OS=Rattus norvegicus OX=10116 GN=Serpinf2 PE=1 SV=1
11	P97298	9.58e-40	150	417	0.202	0.242	PEDF_MOUSE Pigment epithelium-derived factor OS=Mus musculus OX=10090 GN=Serpinf1 PE=1 SV=2
12	Q80ZA3	3.77e-39	149	418	0.216	0.258	Q80ZA3_RAT Serine (Or cysteine) peptidase inhibitor, clade F, member 1 OS=Rattus norvegicus OX=10116 GN=Serpinf1 PE=2 SV=1
13	P36955	2.95e-38	146	418	0.192	0.230	PEDF_HUMAN Pigment epithelium-derived factor OS=Homo sapiens OX=9606 GN=SERPINF1 PE=1 SV=4
14	Q3ZEJ6	4.69e-38	145	411	0.222	0.270	SPA33_BOVIN Serpin A3-3 OS=Bos taurus OX=9913 GN=SERPINA3-3 PE=1 SV=2
15	Q9TTE1	2.08e-37	144	411	0.224	0.273	SPA31_BOVIN Serpin A3-1 OS=Bos taurus OX=9913 GN=SERPINA3-1 PE=1 SV=3
16	P29621	1.53e-35	139	417	0.238	0.285	SPA3C_MOUSE Serine protease inhibitor A3C OS=Mus musculus OX=10090 GN=Serpina3c PE=2 SV=1
17	D3Z450	2.55e-35	138	408	0.230	0.282	D3Z450_MOUSE Serine (or cysteine) peptidase inhibitor, clade A, member 3I OS=Mus musculus OX=10090 GN=Serpina3i PE=1 SV=2
18	P01011	6.21e-35	137	423	0.236	0.279	AACT_HUMAN Alpha-1-antichymotrypsin OS=Homo sapiens OX=9606 GN=SERPINA3 PE=1 SV=2
19	A0A8J8XL70	7.43e-34	134	411	0.212	0.258	A0A8J8XL70_RAT Serpin family F member 1 OS=Rattus norvegicus OX=10116 GN=Serpinf1 PE=1 SV=1
20	Q80X76	9.98e-34	134	445	0.212	0.238	SPA3F_MOUSE Serine protease inhibitor A3F OS=Mus musculus OX=10090 GN=Serpina3f PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04886 PT	99	13.9	PT repeat
2	PF00079 Serpin	4.1e-75	265.0	Serpin (serine protease inhibitor)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000278407

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385035	0.999	Complement C1s subcomponent
2	9606.ENSP00000438615	0.999	Complement C1r subcomponent
3	9606.ENSP00000326159	0.983	Kallikrein-4
4	9606.ENSP00000264690	0.982	Plasma kallikrein
5	9606.ENSP00000253496	0.980	Coagulation factor XII
6	9606.ENSP00000383690	0.972	Mannan-binding lectin serine protease 2
7	9606.ENSP00000313967	0.940	Complement C1q subcomponent subunit B
8	9606.ENSP00000363773	0.936	Complement C1q subcomponent subunit A
9	9606.ENSP00000296280	0.927	Mannan binding lectin serine peptidase 1
10	9606.ENSP00000363770	0.927	Complement C1q subcomponent subunit C
11	9606.ENSP00000363079	0.903	Mannose-binding protein C
12	9606.ENSP00000245907	0.875	Complement C3
13	9606.ENSP00000265023	0.868	Kininogen-1
14	9606.ENSP00000225698	0.818	Complement component 1 Q subcomponent-binding protein, mitochondrial
15	9606.ENSP00000323929	0.746	Alpha-2-macroglobulin
16	9606.ENSP00000415941	0.738	Complement C4-B
17	9606.ENSP00000396688	0.737	Complement C4-A
18	9606.ENSP00000416561	0.728	Complement factor B
19	9606.ENSP00000308938	0.703	Plasminogen
20	9606.ENSP00000438248	0.697	Calumenin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004867	1.000	serine-type endopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050789	0.989	regulation of biological process
GO:0032102	0.941	negative regulation of response to external stimulus
GO:0031348	0.923	negative regulation of defense response
GO:0002683	0.922	negative regulation of immune system process
GO:0002697	0.921	regulation of immune effector process
GO:0002920	0.896	regulation of humoral immune response
GO:0050777	0.886	negative regulation of immune response
GO:0002832	0.848	negative regulation of response to biotic stimulus
GO:0002698	0.839	negative regulation of immune effector process
GO:0045824	0.834	negative regulation of innate immune response
GO:0050896	0.814	response to stimulus
GO:0030449	0.808	regulation of complement activation
GO:0048518	0.755	positive regulation of biological process
GO:0002921	0.657	negative regulation of humoral immune response
GO:0032501	0.621	multicellular organismal process
GO:0050794	0.529	regulation of cellular process
GO:0009987	0.408	cellular process
GO:0051239	0.392	regulation of multicellular organismal process
GO:0048584	0.322	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0071944	0.998	cell periphery
GO:0031982	0.997	vesicle
GO:0012505	0.996	endomembrane system
GO:0005737	0.996	cytoplasm
GO:0070013	0.996	intracellular organelle lumen
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0070062	0.994	extracellular exosome
GO:0030141	0.980	secretory granule
GO:0072562	0.904	blood microparticle
GO:0030312	0.884	external encapsulating structure
GO:0031012	0.832	extracellular matrix
GO:0016020	0.820	membrane
GO:0005783	0.813	endoplasmic reticulum
GO:0062023	0.796	collagen-containing extracellular matrix
GO:0031091	0.624	platelet alpha granule
GO:0005886	0.596	plasma membrane
GO:0034774	0.514	secretory granule lumen
GO:0005788	0.398	endoplasmic reticulum lumen
GO:0031093	0.319	platelet alpha granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]