StarFunc result for job id P05161

User Input

>input (165 residues)
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPL
ASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDD
LFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05161	1.000	1.000	4.187E-36	165	1.000	1.000	P05161.pdb.gz	ISG15_HUMAN Ubiquitin-like protein ISG15 OS=Homo sapiens OX=9606 GN=ISG15 PE=1 SV=5
2	PDB:7rbsB	0.828	0.866	9.733E-31	157	0.945	0.994	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
3	AFDB:Q64339	0.923	0.945	9.397E-27	161	0.618	0.634	Q64339.pdb.gz	ISG15_MOUSE Ubiquitin-like protein ISG15 OS=Mus musculus OX=10090 GN=Isg15 PE=1 SV=4
4	PDB:6yvaC	0.801	0.846	2.909E-23	155	0.612	0.652	6yvaC.pdb.gz
5	PDB:6mdhA	0.555	0.605	1.707E-21	149	0.545	0.604	6mdhA.pdb.gz
6	AFDB:L5LC70	0.825	0.868	3.900E-20	156	0.552	0.583	L5LC70.pdb.gz	L5LC70_MYODS Ubiquitin-like protein ISG15 OS=Myotis davidii OX=225400 GN=MDA_GLEAN10007532 PE=1 SV=1
7	AFDB:B5XFU9	0.557	0.581	1.753E-17	156	0.309	0.327	B5XFU9.pdb.gz	B5XFU9_SALSA Ubiquitin-like protein OS=Salmo salar OX=8030 GN=UBIL PE=2 SV=1
8	AFDB:P0CG71	0.481	0.124	2.068E-16	838	0.309	0.061	P0CG71.pdb.gz	UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans OX=6239 GN=ubq-1 PE=3 SV=1
9	AFDB:Q9FHQ6	0.502	0.282	2.199E-16	322	0.297	0.152	Q9FHQ6.pdb.gz	UBQ9_ARATH Polyubiquitin 9 OS=Arabidopsis thaliana OX=3702 GN=UBQ9 PE=3 SV=1
10	AFDB:Q39256	0.493	0.157	5.216E-16	631	0.291	0.076	Q39256.pdb.gz	UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana OX=3702 GN=UBQ8 PE=3 SV=1
11	AFDB:R9PY16	0.475	0.284	7.553E-16	301	0.279	0.153	R9PY16.pdb.gz	R9PY16_DROME Ubiquitin-like domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Ubi-p5E5 PE=4 SV=1
12	AFDB:F4I9X6	0.486	0.283	1.094E-15	319	0.315	0.163	F4I9X6.pdb.gz	F4I9X6_ARATH Ubiquitin 13 OS=Arabidopsis thaliana OX=3702 GN=UBQ13 PE=1 SV=1
13	AFDB:Q15646	0.544	0.212	2.759E-15	514	0.242	0.078	Q15646.pdb.gz	OASL_HUMAN 2'-5'-oligoadenylate synthase-like protein OS=Homo sapiens OX=9606 GN=OASL PE=1 SV=2
14	PDB:3dbhI	0.459	0.847	8.927E-8	86	0.127	0.244	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
15	PDB:3ai5A	0.429	0.240	1.991E-7	299	0.145	0.080	3ai5A.pdb.gz
16	PDB:3plvA	0.451	0.895	3.469E-7	80	0.085	0.175	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
17	PDB:6pyuA	0.347	0.071	4.174E-7	930	0.152	0.027	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
18	PDB:4pyuA	0.432	0.895	4.439E-7	76	0.061	0.132	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
19	PDB:7lq1A	0.367	0.072	1.525E-6	950	0.152	0.026	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
20	PDB:5xqmA	0.424	0.741	1.725E-6	90	0.085	0.156	5xqmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05161	8.14e-119	334	165	1.000	1.000	ISG15_HUMAN Ubiquitin-like protein ISG15 OS=Homo sapiens OX=9606 GN=ISG15 PE=1 SV=5
2	Q64339	2.55e-65	198	161	0.630	0.646	ISG15_MOUSE Ubiquitin-like protein ISG15 OS=Mus musculus OX=10090 GN=Isg15 PE=1 SV=4
3	L5LC70	8.60e-50	159	156	0.503	0.532	L5LC70_MYODS Ubiquitin-like protein ISG15 OS=Myotis davidii OX=225400 GN=MDA_GLEAN10007532 PE=1 SV=1
4	B5XFU9	5.71e-20	83.2	156	0.321	0.340	B5XFU9_SALSA Ubiquitin-like protein OS=Salmo salar OX=8030 GN=UBIL PE=2 SV=1
5	Q29W12	9.97e-20	82.4	156	0.321	0.340	Q29W12_SALSA ISG15-like protein OS=Salmo salar OX=8030 GN=LOC100136541 PE=2 SV=1
6	P0CH33	6.26e-17	77.0	229	0.321	0.231	UBQ11_ARATH Polyubiquitin 11 OS=Arabidopsis thaliana OX=3702 GN=UBQ11 PE=2 SV=1
7	Q3E7K8	1.14e-16	76.3	230	0.321	0.230	UBQ12_ARATH Polyubiquitin 12 OS=Arabidopsis thaliana OX=3702 GN=UBQ12 PE=3 SV=1
8	Q3E7T8	1.37e-16	77.0	305	0.321	0.174	UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana OX=3702 GN=UBQ14 PE=2 SV=2
9	Q1EC66	1.43e-16	77.0	306	0.321	0.173	UBQ3_ARATH Polyubiquitin 3 OS=Arabidopsis thaliana OX=3702 GN=UBQ3 PE=2 SV=1
10	P0CH32	2.47e-16	77.0	382	0.321	0.139	UBQ4_ARATH Polyubiquitin 4 OS=Arabidopsis thaliana OX=3702 GN=UBQ4 PE=3 SV=1
11	Q8H159	3.08e-16	77.0	457	0.321	0.116	UBQ10_ARATH Polyubiquitin 10 OS=Arabidopsis thaliana OX=3702 GN=UBQ10 PE=2 SV=2
12	P62972	4.09e-16	73.6	167	0.309	0.305	UBIQP_XENLA Polyubiquitin (Fragment) OS=Xenopus laevis OX=8355 PE=1 SV=2
13	Q5ADS0	6.38e-16	74.3	229	0.309	0.223	UBI4P_CANAL Polyubiquitin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBI4 PE=3 SV=1
14	P0CG47	1.24e-15	73.6	229	0.309	0.223	UBB_HUMAN Polyubiquitin-B OS=Homo sapiens OX=9606 GN=UBB PE=1 SV=1
15	Q5U5U6	1.24e-15	73.6	229	0.309	0.223	Q5U5U6_HUMAN Epididymis secretory protein Li 50 OS=Homo sapiens OX=9606 GN=UBB PE=1 SV=1
16	P0CG71	2.10e-15	74.7	838	0.309	0.061	UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans OX=6239 GN=ubq-1 PE=3 SV=1
17	P0CG63	2.30e-15	74.3	381	0.309	0.134	UBI4P_YEAST Polyubiquitin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBI4 PE=1 SV=1
18	P0CG72	2.76e-15	73.9	382	0.309	0.134	UBI4P_SCHPO Polyubiquitin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubi4 PE=1 SV=1
19	Q8MT02	3.12e-15	73.6	306	0.309	0.167	Q8MT02_DROME GH17513p OS=Drosophila melanogaster OX=7227 GN=Ubi-p5E PE=2 SV=1
20	P0CG53	3.56e-15	73.2	305	0.309	0.167	UBB_BOVIN Polyubiquitin-B OS=Bos taurus OX=9913 GN=UBB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20147 Crinkler	1.3e+02	14.7	Crinkler effector protein N-terminal domain
2	PF10302 Dsc3_N	1.2e+02	14.7	DSC E3 ubiquitin ligase complex subunit 3, ubiquitin-like domain
3	PF11976 Rad60-SLD	0.018	26.2	Ubiquitin-2 like Rad60 SUMO-like
4	PF00240 ubiquitin	5.7e-30	114.2	Ubiquitin family
5	PF14560 Ubiquitin_2	0.12	24.1	Ubiquitin-like domain
6	PF18036 Ubiquitin_4	30	16.1	Ubiquitin-like domain
7	PF18037 Ubiquitin_5	3.5	19.4	Ubiquitin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368699

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215794	0.999	Ubl carboxyl-terminal hydrolase 18
2	9606.ENSP00000333266	0.999	Ubiquitin-like modifier-activating enzyme 7
3	9606.ENSP00000371471	0.997	Radical S-adenosyl methionine domain-containing protein 2
4	9606.ENSP00000388001	0.997	2'-5'-oligoadenylate synthase 1
5	9606.ENSP00000342513	0.996	Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis . However, it has also been shown to have a pro-apoptotic activity . Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation is required for entry of the virus into cells . ECO:0000269\|PubMed:17823654, ECO:0000269\|PubMed:25757571,
6	9606.ENSP00000360883	0.996	Interferon-induced protein with tetratricopeptide repeats 3
7	9606.ENSP00000380697	0.996	Interferon regulatory factor 7
8	9606.ENSP00000264350	0.995	E3 ISG15--protein ligase HERC5
9	9606.ENSP00000360891	0.995	Interferon-induced protein with tetratricopeptide repeats 2
10	9606.ENSP00000228928	0.994	2'-5'-oligoadenylate synthase 3
11	9606.ENSP00000257570	0.994	2'-5'-oligoadenylate synthase-like protein
12	9606.ENSP00000342278	0.994	2'-5'-oligoadenylate synthase 2
13	9606.ENSP00000360869	0.994	Interferon-induced protein with tetratricopeptide repeats 1
14	9606.ENSP00000381601	0.994	Interferon-induced GTP-binding protein Mx1
15	9606.ENSP00000483430	0.994	Interferon alpha-inducible protein 27, mitochondrial
16	9606.ENSP00000369213	0.993	Probable ATP-dependent RNA helicase DDX58
17	9606.ENSP00000380073	0.993	Interferon regulatory factor 9
18	9606.ENSP00000395590	0.991	Interferon-induced 35 kDa protein
19	9606.ENSP00000386187	0.989	Interferon-induced transmembrane protein 1
20	9606.ENSP00000424827	0.988	E3 ubiquitin-protein ligase NEDD4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050839	0.998	cell adhesion molecule binding
GO:0005102	0.998	signaling receptor binding
GO:0044877	0.997	protein-containing complex binding
GO:0005178	0.992	integrin binding
GO:1901363	0.577	heterocyclic compound binding
GO:0097159	0.577	organic cyclic compound binding
GO:0003676	0.353	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0050789	0.992	regulation of biological process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:0009987	0.990	cellular process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0043170	0.983	macromolecule metabolic process
GO:0048518	0.976	positive regulation of biological process
GO:0006950	0.974	response to stress
GO:0050794	0.973	regulation of cellular process
GO:0051707	0.955	response to other organism
GO:1901564	0.954	organonitrogen compound metabolic process
GO:0006952	0.950	defense response
GO:0044237	0.949	cellular metabolic process
GO:0051239	0.943	regulation of multicellular organismal process
GO:0019538	0.943	protein metabolic process
GO:0019222	0.934	regulation of metabolic process
GO:0060255	0.909	regulation of macromolecule metabolic process
GO:0051716	0.902	cellular response to stimulus
GO:0098542	0.881	defense response to other organism
GO:0051240	0.874	positive regulation of multicellular organismal process
GO:0070647	0.874	protein modification by small protein conjugation or removal
GO:0009615	0.862	response to virus
GO:0048522	0.855	positive regulation of cellular process
GO:0045088	0.853	regulation of innate immune response
GO:0051607	0.851	defense response to virus
GO:0080090	0.847	regulation of primary metabolic process
GO:0051171	0.847	regulation of nitrogen compound metabolic process
GO:0001817	0.845	regulation of cytokine production
GO:0045087	0.829	innate immune response
GO:0034097	0.824	response to cytokine
GO:0048519	0.806	negative regulation of biological process
GO:0050792	0.802	regulation of viral process
GO:0010604	0.796	positive regulation of macromolecule metabolic process
GO:0009966	0.790	regulation of signal transduction
GO:0048523	0.787	negative regulation of cellular process
GO:0001819	0.786	positive regulation of cytokine production
GO:0045069	0.782	regulation of viral genome replication
GO:0048525	0.777	negative regulation of viral process
GO:0007154	0.766	cell communication
GO:0007165	0.760	signal transduction
GO:0051246	0.727	regulation of protein metabolic process
GO:0060759	0.715	regulation of response to cytokine stimulus
GO:0009892	0.696	negative regulation of metabolic process
GO:0010605	0.688	negative regulation of macromolecule metabolic process
GO:0045071	0.685	negative regulation of viral genome replication
GO:0001959	0.679	regulation of cytokine-mediated signaling pathway
GO:0060338	0.663	regulation of type I interferon-mediated signaling pathway
GO:0002683	0.661	negative regulation of immune system process
GO:0031399	0.652	regulation of protein modification process
GO:0032479	0.638	regulation of type I interferon production
GO:0007166	0.638	cell surface receptor signaling pathway
GO:0032648	0.626	regulation of interferon-beta production
GO:0048585	0.625	negative regulation of response to stimulus
GO:0034340	0.619	response to type I interferon
GO:1903320	0.608	regulation of protein modification by small protein conjugation or removal
GO:0032102	0.605	negative regulation of response to external stimulus
GO:0032728	0.600	positive regulation of interferon-beta production
GO:0031348	0.599	negative regulation of defense response
GO:0045824	0.594	negative regulation of innate immune response
GO:0051172	0.555	negative regulation of nitrogen compound metabolic process
GO:0032649	0.533	regulation of type II interferon production
GO:0001960	0.519	negative regulation of cytokine-mediated signaling pathway
GO:0051248	0.465	negative regulation of protein metabolic process
GO:0009617	0.459	response to bacterium
GO:0032653	0.459	regulation of interleukin-10 production
GO:0007229	0.455	integrin-mediated signaling pathway
GO:0031396	0.454	regulation of protein ubiquitination
GO:0042742	0.449	defense response to bacterium
GO:0032446	0.441	protein modification by small protein conjugation
GO:0032733	0.430	positive regulation of interleukin-10 production
GO:0044260	0.417	cellular macromolecule metabolic process
GO:0031323	0.365	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.995	nucleoplasm
GO:0005576	0.989	extracellular region
GO:0005615	0.539	extracellular space
GO:0032991	0.354	protein-containing complex
GO:0016020	0.329	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]