StarFunc result for job id P05165

User Input

>input (728 residues)
MAGFWVGTAPLVAAGRRGRWPPQQLMLSAALRTLKHVLYYSRQCLMVSRNLGSVGYDPNE
KTFDKILVANRGEIACRVIRTCKKMGIKTVAIHSDVDASSVHVKMADEAVCVGPAPTSKS
YLNMDAIMEAIKKTRAQAVHPGYGFLSENKEFARCLAAEDVVFIGPDTHAIQAMGDKIES
KLLAKKAEVNTIPGFDGVVKDAEEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETRD
GFRLSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLGDKHGNALWLNERECSIQRRNQKVV
EEAPSIFLDAETRRAMGEQAVALARAVKYSSAGTVEFLVDSKKNFYFLEMNTRLQVEHPV
TECITGLDLVQEMIRVAKGYPLRHKQADIRINGWAVECRVYAEDPYKSFGLPSIGRLSQY
QEPLHLPGVRVDSGIQPGSDISIYYDPMISKLITYGSDRTEALKRMADALDNYVIRGVTH
NIALLREVIINSRFVKGDISTKFLSDVYPDGFKGHMLTKSEKNQLLAIASSLFVAFQLRA
QHFQENSRMPVIKPDIANWELSVKLHDKVHTVVASNNGSVFSVEVDGSKLNVTSTWNLAS
PLLSVSVDGTQRTVQCLSREAGGNMSIQFLGTVYKVNILTRLAAELNKFMLEKVTEDTSS
VLRSPMPGVVVAVSVKPGDAVAEGQEICVIEAMKMQNSMTAGKTGTVKSVHCQAGDTVGE
GDLLVELE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05165	1.000	1.000	0.000	728	1.000	1.000	P05165.pdb.gz	PCCA_HUMAN Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCA PE=1 SV=4
2	AFDB:P0DTA4	0.945	0.943	0.000	730	0.897	0.895	P0DTA4.pdb.gz	PCCA_PIG Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Sus scrofa OX=9823 GN=PCCA PE=1 SV=1
3	AFDB:P14882	0.929	0.918	0.000	737	0.882	0.871	P14882.pdb.gz	PCCA_RAT Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pcca PE=1 SV=3
4	AFDB:Q19842	0.896	0.901	2.482E-101	724	0.559	0.562	Q19842.pdb.gz	PCCA_CAEEL Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pcca-1 PE=1 SV=1
5	AFDB:Q5LUF3	0.833	0.888	4.475E-91	681	0.490	0.524	Q5LUF3.pdb.gz	PCCA_RUEPO Propionyl-CoA carboxylase alpha chain OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=pccA PE=1 SV=1
6	AFDB:Q553S7	0.888	0.905	2.123E-90	714	0.492	0.501	Q553S7.pdb.gz	Q553S7_DICDI propionyl-CoA carboxylase OS=Dictyostelium discoideum OX=44689 GN=pccA PE=4 SV=1
7	AFDB:Q9HZV6	0.792	0.867	3.261E-77	661	0.378	0.416	Q9HZV6.pdb.gz	Q9HZV6_PSEAE Geranyl-CoA carboxylase, alpha-subunit (Biotin-containing) OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=atuF PE=4 SV=1
8	PDB:3n6rG	0.724	0.810	2.352E-76	646	0.467	0.526	3n6rG.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
9	AFDB:Q99MR8	0.771	0.782	4.369E-76	717	0.367	0.372	Q99MR8.pdb.gz	MCCA_MOUSE Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2
10	AFDB:A0A0S2Z693	0.809	0.812	4.602E-76	725	0.374	0.375	A0A0S2Z693.pdb.gz	A0A0S2Z693_HUMAN Methylcrotonoyl-CoA carboxylase 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=MCCC1 PE=2 SV=1
11	AFDB:Q42523	0.784	0.778	1.869E-75	734	0.372	0.369	Q42523.pdb.gz	MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MCCA PE=1 SV=2
12	PDB:3n6rA	0.711	0.868	4.182E-68	591	0.420	0.518	3n6rA.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
13	PDB:3u9sA	0.619	0.715	7.058E-60	621	0.374	0.438	3u9sA.pdb.gz	An unanticipated architecture of the 750-kDa {alpha}6{beta}6 holoenzyme of 3-methylcrotonyl-CoA carboxylase
14	PDB:5cslA	0.647	0.249	5.049E-56	2050	0.269	0.096	5cslA.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
15	PDB:5cslB	0.653	0.249	7.903E-55	2072	0.268	0.094	5cslB.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
16	PDB:1dv2A	0.597	0.959	5.393E-54	450	0.294	0.476	1dv2A.pdb.gz	Movement of the biotin carboxylase B-domain as a result of ATP binding.
17	PDB:1dv1B	0.539	0.897	4.199E-49	428	0.279	0.474	1dv1B.pdb.gz	Movement of the biotin carboxylase B-domain as a result of ATP binding.
18	PDB:5cskB	0.650	0.254	4.906E-49	2017	0.236	0.085	5cskB.pdb.gz
19	PDB:5mlkA	0.600	0.963	7.432E-49	451	0.247	0.399	5mlkA.pdb.gz
20	PDB:5cskA	0.645	0.254	2.328E-48	1996	0.235	0.086	5cskA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05165	0.0	1511	728	1.000	1.000	PCCA_HUMAN Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCA PE=1 SV=4
2	P0DTA4	0.0	1343	730	0.897	0.895	PCCA_PIG Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Sus scrofa OX=9823 GN=PCCA PE=1 SV=1
3	P14882	0.0	1306	737	0.882	0.871	PCCA_RAT Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pcca PE=1 SV=3
4	Q19842	0.0	813	724	0.560	0.564	PCCA_CAEEL Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pcca-1 PE=1 SV=1
5	Q553S7	0.0	669	714	0.497	0.507	Q553S7_DICDI propionyl-CoA carboxylase OS=Dictyostelium discoideum OX=44689 GN=pccA PE=4 SV=1
6	Q5LUF3	0.0	692	681	0.489	0.523	PCCA_RUEPO Propionyl-CoA carboxylase alpha chain OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=pccA PE=1 SV=1
7	Q91ZA3	0.0	1320	724	0.891	0.896	PCCA_MOUSE Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2
8	Q9HZV6	4.01e-168	500	661	0.386	0.425	Q9HZV6_PSEAE Geranyl-CoA carboxylase, alpha-subunit (Biotin-containing) OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=atuF PE=4 SV=1
9	A0A0S2Z693	2.03e-160	483	725	0.380	0.382	A0A0S2Z693_HUMAN Methylcrotonoyl-CoA carboxylase 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=MCCC1 PE=2 SV=1
10	Q96RQ3	2.03e-160	483	725	0.380	0.382	MCCA_HUMAN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC1 PE=1 SV=3
11	Q42523	8.60e-160	481	734	0.390	0.387	MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MCCA PE=1 SV=2
12	Q99MR8	2.53e-156	472	717	0.379	0.385	MCCA_MOUSE Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2
13	Q9I299	5.54e-155	466	655	0.386	0.429	Q9I299_PSEAE Methylcrotonyl-CoA carboxylase, alpha-subunit (Biotin-containing) OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuD PE=1 SV=1
14	P9WPQ3	8.03e-153	461	654	0.378	0.420	ACCA1_MYCTU Biotin-dependent 3-methylcrotonyl-coenzyme A carboxylase alpha1 subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=accA1 PE=1 SV=1
15	Q42777	3.88e-148	451	731	0.376	0.375	MCCA_SOYBN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Glycine max OX=3847 GN=MCCA PE=1 SV=2
16	Q57YQ4	2.45e-146	445	678	0.375	0.403	Q57YQ4_TRYB2 3-methylcrotonyl-CoA carboxylase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.840 PE=4 SV=1
17	F4JYE0	6.82e-143	432	555	0.302	0.396	F4JYE0_ARATH Biotin carboxylase OS=Arabidopsis thaliana OX=3702 GN=CAC2 PE=1 SV=1
18	P24182	7.31e-136	410	449	0.298	0.483	ACCC_ECOLI Biotin carboxylase OS=Escherichia coli (strain K12) OX=83333 GN=accC PE=1 SV=2
19	Q5B440	3.35e-130	404	712	0.357	0.365	Q5B440_EMENI 3-methylcrotonyl-CoA carboxylase biotin-containig subunit3-methylcrotonyl-CoA carboxylase biotin-containing subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04690 PE=4 SV=1
20	I3R7G3	3.72e-129	398	601	0.339	0.411	PCCA_HALMT Propionyl-CoA carboxylase, biotin carboxylase and biotin-carboxyl carrier subunit OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) OX=523841 GN=pccA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02222 ATP-grasp	0.0052	27.9	ATP-grasp domain
2	PF02655 ATP-grasp_3	3	19.3	ATP-grasp domain
3	PF13549 ATP-grasp_5	21	16.0	ATP-grasp domain
4	PF14397 ATPgrasp_ST	64	14.2	Sugar-transfer associated ATP-grasp
5	PF15632 ATPgrasp_Ter	1.2e+02	13.8	ATP-grasp in the biosynthetic pathway with Ter operon
6	PF02785 Biotin_carb_C	7.7e-33	124.2	Biotin carboxylase C-terminal domain
7	PF00289 Biotin_carb_N	1.4e-42	156.1	Biotin carboxylase, N-terminal domain
8	PF00364 Biotin_lipoyl	2e-17	74.1	Biotin-requiring enzyme
9	PF13533 Biotin_lipoyl_2	0.00012	33.1	Biotin-lipoyl like
10	PF09204 Colicin_immun	55	15.8	Bacterial self-protective colicin-like immunity
11	PF02786 CPSase_L_D2	8.5e-83	288.6	Carbamoyl-phosphate synthase L chain, ATP binding domain
12	PF07478 Dala_Dala_lig_C	1.8e-06	39.1	D-ala D-ala ligase C-terminus
13	PF01071 GARS_A	2.7e+02	12.7	Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
14	PF13437 HlyD_3	3.1	19.9	HlyD family secretion protein
15	PF16576 HlyD_D23	53	14.5	Barrel-sandwich domain of CusB or HlyD membrane-fusion
16	PF03793 PASTA	3.8e+02	12.4	PASTA domain
17	PF18140 PCC_BT	1.2e-28	111.3	Propionyl-coenzyme A carboxylase BT domain
18	PF08443 RimK	0.091	23.9	RimK-like ATP-grasp domain
19	PF02258 SLT_beta	1.2e+02	14.2	Shiga-like toxin beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365462

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419027	0.999	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA . Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxy [...]
2	9606.ENSP00000382071	0.991	Biotin--protein ligase
3	9606.ENSP00000318351	0.988	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
4	9606.ENSP00000343657	0.979	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial
5	9606.ENSP00000244217	0.978	Methylmalonyl-CoA epimerase, mitochondrial
6	9606.ENSP00000269980	0.977	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
7	9606.ENSP00000359151	0.973	Dihydrolipoamide branched chain transacylase E2
8	9606.ENSP00000450436	0.959	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
9	9606.ENSP00000242592	0.954	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
10	9606.ENSP00000328551	0.942	Ras-related protein Rab-28
11	9606.ENSP00000325136	0.940	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
12	9606.ENSP00000333664	0.940	3-ketoacyl-CoA thiolase, peroxisomal
13	9606.ENSP00000449535	0.938	Acyl-CoA synthetase short-chain family member 3, mitochondrial
14	9606.ENSP00000285093	0.937	3-ketoacyl-CoA thiolase, mitochondrial
15	9606.ENSP00000274813	0.930	Methylmalonyl-CoA mutase, mitochondrial
16	9606.ENSP00000205402	0.927	Dihydrolipoyl dehydrogenase, mitochondrial
17	9606.ENSP00000293217	0.925	Peroxisomal acyl-coenzyme A oxidase 1
18	9606.ENSP00000316924	0.922	Acetyl-coenzyme A synthetase 2-like, mitochondrial
19	9606.ENSP00000253382	0.919	Acetyl-coenzyme A synthetase, cytoplasmic
20	9606.ENSP00000348775	0.919	Peroxisomal acyl-coenzyme A oxidase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016421	0.998	CoA carboxylase activity
GO:0005488	0.993	binding
GO:0005515	0.973	protein binding
GO:0004658	0.475	propionyl-CoA carboxylase activity
GO:0042802	0.442	identical protein binding
GO:1901363	0.434	heterocyclic compound binding
GO:0097159	0.408	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.999	primary metabolic process
GO:0046395	0.996	carboxylic acid catabolic process
GO:0032787	0.995	monocarboxylic acid metabolic process
GO:0006629	0.984	lipid metabolic process
GO:0009062	0.956	fatty acid catabolic process
GO:0046459	0.609	short-chain fatty acid metabolic process
GO:0006807	0.413	nitrogen compound metabolic process
GO:1901564	0.324	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.956	intracellular organelle lumen
GO:0005829	0.346	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.4.-.-	0.998	Forming carbon-carbon bonds.
RHEA:23720	0.475	ATP + hydrogencarbonate + propanoyl-CoA = (S)-methylmalonyl-CoA + ADP + H(+) + phosphate
EC:6.4.1.3	0.475	propionyl-CoA carboxylase.

[back to server]