StarFunc result for job id P05166

User Input

>input (539 residues)
MAAALRVAAVGARLSVLASGLRAAVRSLCSQATSVNERIENKRRTALLGGGQRRIDAQHK
RGKLTARERISLLLDPGSFVESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVY
VFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIF
LRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVT
QEELGGAKTHTTMSGVAHRAFENDVDALCNLRDFFNYLPLSSQDPAPVRECHDPSDRLVP
ELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPK
VASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFA
EATVPKVTVITRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVE
AAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVLASKKVQRPWRKHANIPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07633	0.953	0.950	0.000	541	0.891	0.887	P07633.pdb.gz	PCCB_RAT Propionyl-CoA carboxylase beta chain, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pccb PE=2 SV=1
2	AFDB:Q8T131	0.930	0.906	1.191E-92	553	0.629	0.613	Q8T131.pdb.gz	Q8T131_DICDI Propionyl-CoA carboxylase OS=Dictyostelium discoideum OX=44689 GN=pccB PE=4 SV=1
3	AFDB:Q5LUG0	0.928	0.980	1.534E-91	510	0.620	0.655	Q5LUG0.pdb.gz	Q5LUG0_RUEPO Propionyl-CoA carboxylase, beta subunit OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=pccB PE=1 SV=1
4	AFDB:Q168G2	0.929	0.982	2.210E-91	510	0.623	0.659	Q168G2.pdb.gz	PCCB_ROSDO Propionyl-CoA carboxylase beta chain OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) OX=375451 GN=pccB PE=1 SV=1
5	AFDB:I3R7F1	0.922	0.963	5.057E-87	516	0.564	0.589	I3R7F1.pdb.gz	PCCB_HALMT Propionyl-CoA carboxylase, carboxyltransferase subunit OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) OX=523841 GN=pccB PE=1 SV=1
6	PDB:3n6rB	0.923	0.983	5.237E-84	506	0.623	0.664	3n6rB.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
7	AFDB:P9WQH7	0.913	0.898	6.209E-78	548	0.510	0.502	P9WQH7.pdb.gz	ACCD5_MYCTU Biotin-dependent acetyl-/propionyl-coenzyme A carboxylase beta5 subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=accD5 PE=1 SV=1
8	AFDB:O53578	0.894	0.922	1.294E-70	522	0.421	0.435	O53578.pdb.gz	ACCD4_MYCTU Biotin-dependent long chain acyl-coenzyme A carboxylase beta4 subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=accD4 PE=1 SV=2
9	PDB:2a7sA	0.919	0.936	2.120E-70	529	0.512	0.522	2a7sA.pdb.gz
10	AFDB:P9WQH5	0.761	0.865	3.703E-55	473	0.349	0.397	P9WQH5.pdb.gz	ACCD6_MYCTU Biotin-dependent acetyl-/propionyl-coenzyme A carboxylase beta6 subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=accD6 PE=1 SV=1
11	AFDB:Q9LDD8	0.820	0.755	1.379E-50	587	0.291	0.267	Q9LDD8.pdb.gz	MCCB_ARATH Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MCCB PE=2 SV=1
12	AFDB:A0A140VK29	0.410	0.394	1.170E-48	563	0.288	0.275	A0A140VK29.pdb.gz	A0A140VK29_HUMAN methylcrotonoyl-CoA carboxylase OS=Homo sapiens OX=9606 PE=2 SV=1
13	PDB:4g2rB	0.735	0.892	9.328E-48	441	0.312	0.381	4g2rB.pdb.gz	Structure, Activity, and Inhibition of the Carboxyltransferase beta-Subunit of Acetyl Coenzyme A Carboxylase (AccD6) from Mycobacterium tuberculosis.
14	PDB:4l6wB	0.696	0.890	5.496E-46	419	0.301	0.387	4l6wB.pdb.gz
15	PDB:5iklB	0.398	0.417	2.155E-42	514	0.254	0.267	5iklB.pdb.gz
16	PDB:3u9sF	0.399	0.401	2.290E-42	537	0.289	0.291	3u9sF.pdb.gz	An unanticipated architecture of the 750-kDa {alpha}6{beta}6 holoenzyme of 3-methylcrotonyl-CoA carboxylase
17	PDB:4rcnB	0.764	0.424	9.953E-41	1000	0.232	0.125	4rcnB.pdb.gz
18	PDB:4rcnA	0.769	0.439	1.270E-40	972	0.219	0.121	4rcnA.pdb.gz
19	PDB:5cskB	0.699	0.197	2.007E-30	2017	0.186	0.050	5cskB.pdb.gz
20	PDB:3u9tB	0.336	0.411	9.183E-30	437	0.234	0.288	3u9tB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	I3R7F1	0.0	636	516	0.570	0.595	PCCB_HALMT Propionyl-CoA carboxylase, carboxyltransferase subunit OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) OX=523841 GN=pccB PE=1 SV=1
2	P05166	0.0	1109	539	1.000	1.000	PCCB_HUMAN Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCB PE=1 SV=3
3	P07633	0.0	1033	541	0.915	0.911	PCCB_RAT Propionyl-CoA carboxylase beta chain, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pccb PE=2 SV=1
4	P79384	0.0	1045	539	0.924	0.924	PCCB_PIG Propionyl-CoA carboxylase beta chain, mitochondrial OS=Sus scrofa OX=9823 GN=PCCB PE=1 SV=1
5	P9WQH7	0.0	522	548	0.516	0.507	ACCD5_MYCTU Biotin-dependent acetyl-/propionyl-coenzyme A carboxylase beta5 subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=accD5 PE=1 SV=1
6	Q168G2	0.0	699	510	0.623	0.659	PCCB_ROSDO Propionyl-CoA carboxylase beta chain OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) OX=375451 GN=pccB PE=1 SV=1
7	Q5LUG0	0.0	694	510	0.620	0.655	Q5LUG0_RUEPO Propionyl-CoA carboxylase, beta subunit OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=pccB PE=1 SV=1
8	Q8T131	0.0	705	553	0.629	0.613	Q8T131_DICDI Propionyl-CoA carboxylase OS=Dictyostelium discoideum OX=44689 GN=pccB PE=4 SV=1
9	Q99MN9	0.0	1033	541	0.915	0.911	PCCB_MOUSE Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2
10	O53578	4.48e-143	424	522	0.436	0.450	ACCD4_MYCTU Biotin-dependent long chain acyl-coenzyme A carboxylase beta4 subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=accD4 PE=1 SV=2
11	P9WQH5	2.49e-96	302	473	0.340	0.387	ACCD6_MYCTU Biotin-dependent acetyl-/propionyl-coenzyme A carboxylase beta6 subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=accD6 PE=1 SV=1
12	O06165	5.33e-74	246	529	0.325	0.331	O06165_MYCTO Propionyl-CoA carboxylase, beta subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pccB-3 PE=3 SV=1
13	Q9V9A7	3.29e-69	234	578	0.317	0.296	MCCB_DROME Probable methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Mccc2 PE=2 SV=1
14	Q9I297	1.06e-66	227	535	0.317	0.320	Q9I297_PSEAE Methylcrotonyl-CoA carboxylase, beta-subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuB PE=1 SV=1
15	Q9LDD8	1.63e-66	228	587	0.291	0.267	MCCB_ARATH Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MCCB PE=2 SV=1
16	P34385	1.89e-66	228	608	0.295	0.262	MCCB_CAEEL Probable methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=F02A9.10 PE=3 SV=1
17	Q3ULD5	1.92e-66	227	563	0.314	0.300	MCCB_MOUSE Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Mccc2 PE=1 SV=1
18	C8VAZ1	5.01e-66	226	588	0.295	0.270	C8VAZ1_EMENI methylcrotonoyl-CoA carboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04687 PE=3 SV=1
19	Q5XIT9	6.78e-65	223	563	0.308	0.295	MCCB_RAT Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Rattus norvegicus OX=10116 GN=Mccc2 PE=2 SV=1
20	A0A140VK29	6.93e-63	217	563	0.312	0.298	A0A140VK29_HUMAN methylcrotonoyl-CoA carboxylase OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01039 Carboxyl_trans	3.2e-192	651.2	Carboxyl transferase domain
2	PF06833 MdcE	1.4e+02	13.4	Malonate decarboxylase gamma subunit (MdcE)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000026589

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000010202	0.999	Propionyl CoA carboxylase, alpha polypeptide
2	9598.ENSPTRP00000001722	0.994	Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial
3	9598.ENSPTRP00000020670	0.990	Uncharacterized protein
4	9598.ENSPTRP00000027424	0.977	Uncharacterized protein
5	9598.ENSPTRP00000031400	0.976	Branched chain keto acid dehydrogenase E1, beta polypeptide
6	9598.ENSPTRP00000018933	0.963	The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3)
7	9598.ENSPTRP00000026948	0.958	Methylcrotonoyl-CoA carboxylase 1 (Alpha)
8	9598.ENSPTRP00000011082	0.954	Aldehyde dehydrogenase 6 family, member A1
9	9598.ENSPTRP00000025446	0.945	Acetyl-CoA acyltransferase 1
10	9598.ENSPTRP00000020160	0.944	Trifunctional enzyme subunit beta, mitochondrial
11	9598.ENSPTRP00000007309	0.941	Acetyl-CoA acetyltransferase 1
12	9598.ENSPTRP00000009412	0.940	Acyl-CoA dehydrogenase, C-2 to C-3 short chain
13	9598.ENSPTRP00000017023	0.940	Acetyl-CoA acyltransferase 2
14	9598.ENSPTRP00000055489	0.940	Uncharacterized protein
15	9598.ENSPTRP00000011814	0.938	Isovaleryl-CoA dehydrogenase
16	9598.ENSPTRP00000016422	0.933	Acyl-coenzyme A oxidase
17	9598.ENSPTRP00000027397	0.933	Belongs to the acyl-CoA oxidase family.
18	9598.ENSPTRP00000022860	0.913	acyl-CoA synthetase short-chain family member 1
19	9598.ENSPTRP00000023022	0.913	Uncharacterized protein
20	9598.ENSPTRP00000031719	0.910	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016421	1.000	CoA carboxylase activity
GO:0005515	0.999	protein binding
GO:0004658	0.741	propionyl-CoA carboxylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009062	0.998	fatty acid catabolic process
GO:0046459	0.738	short-chain fatty acid metabolic process
GO:0006807	0.355	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.951	intracellular organelle lumen
GO:0005759	0.601	mitochondrial matrix
GO:0032991	0.444	protein-containing complex
GO:0005829	0.425	cytosol
GO:0031981	0.374	nuclear lumen
GO:1902494	0.353	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.4.-.-	1.000	Forming carbon-carbon bonds.
RHEA:23720	0.741	ATP + hydrogencarbonate + propanoyl-CoA = (S)-methylmalonyl-CoA + ADP + H(+) + phosphate
EC:6.4.1.3	0.741	propionyl-CoA carboxylase.

[back to server]