StarFunc result for job id P05198

User Input

>input (315 residues)
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05198	1.000	1.000	6.265E-62	315	1.000	1.000	P05198.pdb.gz	IF2A_HUMAN Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=1 SV=3
2	AFDB:M9T5Z6	0.926	0.880	9.343E-47	332	0.613	0.581	M9T5Z6.pdb.gz	M9T5Z6_PENVA Eukaryotic translation initiation factor 2 subunit 1 OS=Penaeus vannamei OX=6689 GN=eIF2a PE=2 SV=1
3	AFDB:P41374	0.936	0.866	1.955E-46	341	0.603	0.557	P41374.pdb.gz	IF2A_DROME Eukaryotic translation initiation factor 2 subunit 1 OS=Drosophila melanogaster OX=7227 GN=eIF2alpha PE=2 SV=1
4	PDB:1q8kA	0.586	0.608	1.490E-44	300	0.940	0.987	1q8kA.pdb.gz
5	AFDB:P56286	0.827	0.849	2.730E-42	306	0.524	0.539	P56286.pdb.gz	IF2A_SCHPO Eukaryotic translation initiation factor 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif211 PE=1 SV=1
6	AFDB:P20459	0.827	0.855	2.649E-41	304	0.521	0.539	P20459.pdb.gz	IF2A_YEAST Eukaryotic translation initiation factor 2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUI2 PE=1 SV=1
7	AFDB:Q9FE78	0.875	0.806	9.750E-39	344	0.457	0.419	Q9FE78.pdb.gz	IF2A_ARATH Eukaryotic translation initiation factor 2 subunit alpha OS=Arabidopsis thaliana OX=3702 GN=EIF2A PE=1 SV=1
8	AFDB:Q9SIZ2	0.860	0.792	2.420E-38	344	0.473	0.433	Q9SIZ2.pdb.gz	IF2AH_ARATH Eukaryotic translation initiation factor 2 subunit alpha homolog OS=Arabidopsis thaliana OX=3702 GN=At2g40290 PE=1 SV=2
9	AFDB:A0A509AJP9	0.781	0.757	6.728E-38	326	0.460	0.445	A0A509AJP9.pdb.gz	IF2A_PLABA Eukaryotic translation initiation factor 2 subunit 1 OS=Plasmodium berghei (strain Anka) OX=5823 GN=eIF2alpha PE=1 SV=1
10	AFDB:Q8IBH7	0.766	0.735	9.179E-37	329	0.467	0.447	Q8IBH7.pdb.gz	IF2A_PLAF7 Eukaryotic translation initiation factor 2 subunit 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=eIF2alpha PE=1 SV=1
11	AFDB:Q57ZM2	0.729	0.563	1.851E-31	418	0.311	0.234	Q57ZM2.pdb.gz	Q57ZM2_TRYB2 Elongation initiation factor 2 alpha subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.290 PE=3 SV=1
12	PDB:6k72K	0.553	0.695	3.113E-27	239	0.756	0.996	6k72K.pdb.gz	Structural basis for eIF2B inhibition in integrated stress response.
13	PDB:3j81j	0.688	0.841	1.395E-23	252	0.435	0.544	3j81j.pdb.gz	Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
14	PDB:3cw2C	0.551	0.639	3.059E-17	266	0.213	0.252	3cw2C.pdb.gz	Crystal structure of the intact archaeal translation initiation factor 2 demonstrates very high conformational flexibility in the alpha- and beta-subunits.
15	PDB:6gmhM	0.209	0.070	9.580E-4	1002	0.057	0.018	6gmhM.pdb.gz	Structure of activated transcription complex Pol II-DSIF-PAF-SPT6.
16	PDB:6h4ny	0.223	0.201	1.073E-3	351	0.054	0.048	6h4ny.pdb.gz	Structure of a hibernating 100S ribosome reveals an inactive conformation of the ribosomal protein S1.
17	PDB:4pxbA	0.174	0.138	1.202E-3	423	0.032	0.024	4pxbA.pdb.gz	Structural insights into the substrate specificity of (s)-ureidoglycolate amidohydrolase and its comparison with allantoate amidohydrolase.
18	PDB:7oopM	0.198	0.080	1.202E-3	810	0.054	0.021	7oopM.pdb.gz	Structural basis of human transcription-DNA repair coupling.
19	PDB:1xmbA	0.203	0.176	1.790E-3	375	0.054	0.045	1xmbA.pdb.gz
20	PDB:6tqnA	0.187	0.123	2.005E-3	495	0.051	0.032	6tqnA.pdb.gz	Structure-Based Mechanisms of a Molecular RNA Polymerase/Chaperone Machine Required for Ribosome Biosynthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05198	0.0	643	315	1.000	1.000	IF2A_HUMAN Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=1 SV=3
2	P68101	0.0	638	315	0.990	0.990	IF2A_RAT Eukaryotic translation initiation factor 2 subunit 1 OS=Rattus norvegicus OX=10116 GN=Eif2s1 PE=1 SV=2
3	Q53XC0	0.0	643	315	1.000	1.000	Q53XC0_HUMAN Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=2 SV=1
4	Q6ZWX6	0.0	638	315	0.990	0.990	IF2A_MOUSE Eukaryotic translation initiation factor 2 subunit 1 OS=Mus musculus OX=10090 GN=Eif2s1 PE=1 SV=3
5	Q98TT1	0.0	594	315	0.917	0.917	Q98TT1_ONCMY Eukaryotic translation initiation factor 2 subunit 1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00041348001 PE=2 SV=1
6	M9T5Z6	2.35e-140	401	332	0.625	0.593	M9T5Z6_PENVA Eukaryotic translation initiation factor 2 subunit 1 OS=Penaeus vannamei OX=6689 GN=eIF2a PE=2 SV=1
7	P41374	4.87e-130	375	341	0.587	0.543	IF2A_DROME Eukaryotic translation initiation factor 2 subunit 1 OS=Drosophila melanogaster OX=7227 GN=eIF2alpha PE=2 SV=1
8	P56286	2.29e-114	334	306	0.530	0.546	IF2A_SCHPO Eukaryotic translation initiation factor 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif211 PE=1 SV=1
9	P20459	8.07e-106	313	304	0.508	0.526	IF2A_YEAST Eukaryotic translation initiation factor 2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUI2 PE=1 SV=1
10	Q8IBH7	1.37e-94	285	329	0.476	0.456	IF2A_PLAF7 Eukaryotic translation initiation factor 2 subunit 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=eIF2alpha PE=1 SV=1
11	A0A509AJP9	1.68e-93	282	326	0.463	0.448	IF2A_PLABA Eukaryotic translation initiation factor 2 subunit 1 OS=Plasmodium berghei (strain Anka) OX=5823 GN=eIF2alpha PE=1 SV=1
12	Q9SIZ2	1.25e-87	268	344	0.476	0.436	IF2AH_ARATH Eukaryotic translation initiation factor 2 subunit alpha homolog OS=Arabidopsis thaliana OX=3702 GN=At2g40290 PE=1 SV=2
13	Q9FE78	1.78e-79	247	344	0.454	0.416	IF2A_ARATH Eukaryotic translation initiation factor 2 subunit alpha OS=Arabidopsis thaliana OX=3702 GN=EIF2A PE=1 SV=1
14	Q57ZM2	2.18e-46	163	418	0.308	0.232	Q57ZM2_TRYB2 Elongation initiation factor 2 alpha subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.290 PE=3 SV=1
15	P83268	5.38e-29	107	52	0.162	0.981	IF2A_RABIT Eukaryotic translation initiation factor 2 subunit 1 (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=EIF2S1 PE=1 SV=1
16	Q97Z79	1.60e-16	80.1	266	0.213	0.252	IF2A_SACS2 Translation initiation factor 2 subunit alpha OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=eif2a PE=1 SV=1
17	Q9Z8M3	0.001	43.1	580	0.102	0.055	RS1_CHLPN Small ribosomal subunit protein bS1 OS=Chlamydia pneumoniae OX=83558 GN=rpsA PE=3 SV=1
18	P50849	0.013	39.7	705	0.070	0.031	PNP_BACSU Polyribonucleotide nucleotidyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=pnp PE=1 SV=3
19	Q9LK47	0.035	38.1	392	0.079	0.064	Q9LK47_ARATH AT3g23700/MYM9_3 OS=Arabidopsis thaliana OX=3702 GN=SRRP1 PE=1 SV=1
20	P9WH43	0.040	38.1	481	0.070	0.046	RS1_MYCTU Small ribosomal subunit protein bS1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpsA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14627 DUF4453	6.8e+02	11.8	Domain of unknown function (DUF4453)
2	PF07541 EIF_2_alpha	7.7e-34	127.6	Eukaryotic translation initiation factor 2 alpha subunit
3	PF00575 S1	4.1e-12	57.6	S1 RNA binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000000790

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000002196	0.999	Eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa
2	61853.ENSNLEP00000007422	0.999	Eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa
3	61853.ENSNLEP00000012234	0.999	Eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
4	61853.ENSNLEP00000017293	0.999	Eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa
5	61853.ENSNLEP00000019907	0.999	Eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa
6	61853.ENSNLEP00000022410	0.999	Uncharacterized protein
7	61853.ENSNLEP00000002941	0.998	Eukaryotic translation initiation factor 3 subunit I
8	61853.ENSNLEP00000020219	0.998	Eukaryotic translation initiation factor 3 subunit A
9	61853.ENSNLEP00000004086	0.997	Eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa
10	61853.ENSNLEP00000010568	0.997	Eukaryotic translation initiation factor 3 subunit B
11	61853.ENSNLEP00000014680	0.997	Eukaryotic translation initiation factor 3 subunit G
12	61853.ENSNLEP00000005058	0.996	Eukaryotic translation initiation factor 3 subunit E
13	61853.ENSNLEP00000024428	0.996	Eukaryotic translation initiation factor 3 subunit D
14	61853.ENSNLEP00000012240	0.995	Uncharacterized protein
15	61853.ENSNLEP00000019545	0.995	Eukaryotic translation initiation factor 5
16	61853.ENSNLEP00000001723	0.994	Eukaryotic translation initiation factor 3 subunit C
17	61853.ENSNLEP00000003807	0.993	Eukaryotic translation initiation factor 2-alpha kinase 3
18	61853.ENSNLEP00000003961	0.992	Eukaryotic translation initiation factor 2A
19	61853.ENSNLEP00000005825	0.992	Eukaryotic translation initiation factor 3 subunit H
20	61853.ENSNLEP00000002959	0.991	Eukaryotic translation initiation factor 2 alpha kinase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.937	nucleic acid binding
GO:0003723	0.816	RNA binding
GO:0008135	0.310	translation factor activity, RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0065007	0.991	biological regulation
GO:0050794	0.973	regulation of cellular process
GO:0051716	0.966	cellular response to stimulus
GO:0033554	0.934	cellular response to stress
GO:0008152	0.829	metabolic process
GO:0071704	0.818	organic substance metabolic process
GO:0044238	0.808	primary metabolic process
GO:0006807	0.791	nitrogen compound metabolic process
GO:0044237	0.771	cellular metabolic process
GO:0034976	0.769	response to endoplasmic reticulum stress
GO:0043170	0.733	macromolecule metabolic process
GO:0048518	0.520	positive regulation of biological process
GO:0048522	0.510	positive regulation of cellular process
GO:0034641	0.496	cellular nitrogen compound metabolic process
GO:1901564	0.493	organonitrogen compound metabolic process
GO:0019538	0.484	protein metabolic process
GO:0010467	0.460	gene expression
GO:0019222	0.420	regulation of metabolic process
GO:0042221	0.406	response to chemical
GO:1901576	0.360	organic substance biosynthetic process
GO:0044249	0.352	cellular biosynthetic process
GO:0060255	0.351	regulation of macromolecule metabolic process
GO:0070887	0.350	cellular response to chemical stimulus
GO:0007154	0.343	cell communication
GO:0051171	0.343	regulation of nitrogen compound metabolic process
GO:0080090	0.338	regulation of primary metabolic process
GO:0044260	0.333	cellular macromolecule metabolic process
GO:0044271	0.325	cellular nitrogen compound biosynthetic process
GO:0006518	0.316	peptide metabolic process
GO:0009059	0.310	macromolecule biosynthetic process
GO:1901566	0.305	organonitrogen compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.980	cytosol
GO:0043231	0.969	intracellular membrane-bounded organelle
GO:0005634	0.958	nucleus
GO:0032991	0.931	protein-containing complex
GO:0070013	0.839	intracellular organelle lumen
GO:0031981	0.806	nuclear lumen
GO:0005654	0.780	nucleoplasm
GO:0016020	0.774	membrane
GO:0043232	0.722	intracellular non-membrane-bounded organelle
GO:0070062	0.487	extracellular exosome
GO:1990904	0.485	ribonucleoprotein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]