StarFunc result for job id P05204

User Input

>input (90 residues)
MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKA
DAGKEGNNPAENGDAKTDQAQKAEGAGDAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02313	0.586	0.586	6.174E-10	90	0.978	0.978	P02313.pdb.gz	HMGN2_BOVIN Non-histone chromosomal protein HMG-17 OS=Bos taurus OX=9913 GN=HMGN2 PE=1 SV=2
2	AFDB:O00479	0.412	0.412	3.837E-9	90	0.867	0.867	O00479.pdb.gz	HMGN4_HUMAN High mobility group nucleosome-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=HMGN4 PE=1 SV=3
3	AFDB:P82970	0.197	0.083	3.308	282	0.367	0.117	P82970.pdb.gz	HMGN5_HUMAN High mobility group nucleosome-binding domain-containing protein 5 OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1
4	AFDB:O43306	0.126	0.023	9.290	1168	0.244	0.019	O43306.pdb.gz	ADCY6_HUMAN Adenylate cyclase type 6 OS=Homo sapiens OX=9606 GN=ADCY6 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05204	1.44e-52	160	90	1.000	1.000	HMGN2_HUMAN Non-histone chromosomal protein HMG-17 OS=Homo sapiens OX=9606 GN=HMGN2 PE=1 SV=3
2	P02313	2.12e-51	157	90	0.978	0.978	HMGN2_BOVIN Non-histone chromosomal protein HMG-17 OS=Bos taurus OX=9913 GN=HMGN2 PE=1 SV=2
3	P09602	9.75e-51	156	90	0.967	0.967	HMGN2_MOUSE Non-histone chromosomal protein HMG-17 OS=Mus musculus OX=10090 GN=Hmgn2 PE=1 SV=2
4	P18437	4.95e-35	116	90	0.944	0.944	HMGN2_RAT Non-histone chromosomal protein HMG-17 OS=Rattus norvegicus OX=10116 GN=Hmgn2 PE=1 SV=2
5	O00479	6.23e-34	113	90	0.867	0.867	HMGN4_HUMAN High mobility group nucleosome-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=HMGN4 PE=1 SV=3
6	Q9DCB1	1.04e-18	75.5	99	0.556	0.505	HMGN3_MOUSE High mobility group nucleosome-binding domain-containing protein 3 OS=Mus musculus OX=10090 GN=Hmgn3 PE=1 SV=1
7	Q15651	5.98e-11	55.8	99	0.611	0.556	HMGN3_HUMAN High mobility group nucleosome-binding domain-containing protein 3 OS=Homo sapiens OX=9606 GN=HMGN3 PE=1 SV=2
8	A0A087WZE9	1.10e-08	50.4	130	0.567	0.392	A0A087WZE9_HUMAN High mobility group nucleosomal binding domain 3 OS=Homo sapiens OX=9606 GN=HMGN3 PE=1 SV=1
9	P18608	2.60e-07	46.2	96	0.422	0.396	HMGN1_MOUSE Non-histone chromosomal protein HMG-14 OS=Mus musculus OX=10090 GN=Hmgn1 PE=1 SV=2
10	Q9JL35	6.29e-07	47.4	406	0.300	0.067	HMGN5_MOUSE High mobility group nucleosome-binding domain-containing protein 5 OS=Mus musculus OX=10090 GN=Hmgn5 PE=1 SV=2
11	Q5JSL0	4.23e-06	44.3	148	0.389	0.236	Q5JSL0_HUMAN High mobility group nucleosome binding domain 5 (Fragment) OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1
12	P82970	2.16e-05	43.1	282	0.278	0.089	HMGN5_HUMAN High mobility group nucleosome-binding domain-containing protein 5 OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1
13	P05114	0.015	33.9	100	0.422	0.380	HMGN1_HUMAN Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3
14	Q5JSK6	0.021	34.3	161	0.222	0.124	Q5JSK6_HUMAN High mobility group nucleosome binding domain 5 (Fragment) OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1
15	A6NEL0	0.50	30.0	116	0.322	0.250	A6NEL0_HUMAN High mobility group nucleosome binding domain 1 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=1
16	Q80YN3	0.84	30.0	633	0.156	0.022	BCAS1_MOUSE Breast carcinoma-amplified sequence 1 homolog OS=Mus musculus OX=10090 GN=Bcas1 PE=1 SV=3
17	P02315	3.9	26.9	70	0.189	0.243	H6_ONCMY Non-histone chromosomal protein H6 OS=Oncorhynchus mykiss OX=8022 PE=1 SV=2
18	Q99JF8	4.7	28.1	528	0.222	0.038	PSIP1_MOUSE PC4 and SFRS1-interacting protein OS=Mus musculus OX=10090 GN=Psip1 PE=1 SV=1
19	Q9H9L3	6.3	27.7	353	0.222	0.057	I20L2_HUMAN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Homo sapiens OX=9606 GN=ISG20L2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01101 HMG14_17	5.6e-28	109.1	HMG14 and HMG17

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000022125

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000002968	0.696	High mobility group nucleosome binding domain 5
2	61853.ENSNLEP00000009899	0.667	High mobility group nucleosome binding domain 1
3	61853.ENSNLEP00000022716	0.667	annotation not available
4	61853.ENSNLEP00000011011	0.519	SYF2 pre-mRNA-splicing factor
5	61853.ENSNLEP00000016753	0.514	tRNA (guanine(37)-N1)-methyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0060090	1.000	molecular adaptor activity
GO:0003676	1.000	nucleic acid binding
GO:0005515	0.996	protein binding
GO:0003677	0.985	DNA binding
GO:0003723	0.514	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0019222	0.986	regulation of metabolic process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0019219	0.978	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.968	regulation of DNA-templated transcription
GO:0006950	0.949	response to stress
GO:0006357	0.883	regulation of transcription by RNA polymerase II
GO:0048519	0.794	negative regulation of biological process
GO:0048523	0.774	negative regulation of cellular process
GO:0009892	0.765	negative regulation of metabolic process
GO:0010605	0.760	negative regulation of macromolecule metabolic process
GO:0006959	0.736	humoral immune response
GO:0045934	0.708	negative regulation of nucleobase-containing compound metabolic process
GO:0019730	0.706	antimicrobial humoral response
GO:0051253	0.701	negative regulation of RNA metabolic process
GO:0040034	0.690	regulation of development, heterochronic
GO:0001906	0.652	cell killing
GO:0031327	0.615	negative regulation of cellular biosynthetic process
GO:0010558	0.539	negative regulation of macromolecule biosynthetic process
GO:0045892	0.473	negative regulation of DNA-templated transcription
GO:0061844	0.410	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0008152	0.396	metabolic process
GO:0048522	0.378	positive regulation of cellular process
GO:0010604	0.363	positive regulation of macromolecule metabolic process
GO:0071704	0.357	organic substance metabolic process
GO:0044238	0.315	primary metabolic process
GO:0044237	0.315	cellular metabolic process
GO:0006807	0.309	nitrogen compound metabolic process
GO:0000122	0.305	negative regulation of transcription by RNA polymerase II
GO:0043170	0.301	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.965	intracellular organelle lumen
GO:0031981	0.964	nuclear lumen
GO:0005737	0.956	cytoplasm
GO:0005654	0.951	nucleoplasm
GO:0043228	0.874	non-membrane-bounded organelle
GO:0005576	0.856	extracellular region
GO:0043232	0.854	intracellular non-membrane-bounded organelle
GO:0005615	0.646	extracellular space
GO:0000785	0.629	chromatin
GO:0005739	0.335	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]