StarFunc result for job id P05230

User Input

>input (155 residues)
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61148	0.980	0.980	1.689E-29	155	0.955	0.955	P61148.pdb.gz	FGF1_MOUSE Fibroblast growth factor 1 OS=Mus musculus OX=10090 GN=Fgf1 PE=1 SV=1
2	AFDB:P03968	0.986	0.986	4.370E-29	155	0.923	0.923	P03968.pdb.gz	FGF1_BOVIN Fibroblast growth factor 1 OS=Bos taurus OX=9913 GN=FGF1 PE=1 SV=2
3	AFDB:P19596	0.977	0.977	1.977E-28	155	0.903	0.903	P19596.pdb.gz	FGF1_CHICK Fibroblast growth factor 1 OS=Gallus gallus OX=9031 GN=FGF1 PE=1 SV=2
4	PDB:1ry7A	0.844	0.866	4.209E-25	151	0.974	1.000	1ry7A.pdb.gz
5	AFDB:P48800	0.831	0.815	2.817E-19	158	0.503	0.494	P48800.pdb.gz	FGF2_CHICK Fibroblast growth factor 2 OS=Gallus gallus OX=9031 GN=FGF2 PE=2 SV=1
6	AFDB:P09038	0.842	0.460	3.940E-19	288	0.548	0.295	P09038.pdb.gz	FGF2_HUMAN Fibroblast growth factor 2 OS=Homo sapiens OX=9606 GN=FGF2 PE=1 SV=3
7	AFDB:P12226	0.828	0.828	8.617E-19	155	0.490	0.490	P12226.pdb.gz	FGF2_XENLA Fibroblast growth factor 2 OS=Xenopus laevis OX=8355 GN=fgf2 PE=2 SV=2
8	AFDB:A0A0R4IHF9	0.825	0.830	1.078E-18	154	0.535	0.539	A0A0R4IHF9.pdb.gz
9	AFDB:Q6PBT8	0.843	0.888	3.297E-18	147	0.497	0.524	Q6PBT8.pdb.gz	FGF1_DANRE Putative fibroblast growth factor 1 OS=Danio rerio OX=7955 GN=fgf1 PE=2 SV=1
10	AFDB:A0A060Y7E5	0.807	0.807	6.820E-18	155	0.477	0.477	A0A060Y7E5.pdb.gz	A0A060Y7E5_ONCMY Fibroblast growth factor OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00000746001 PE=3 SV=1
11	AFDB:G1NDN4	0.790	0.832	5.051E-16	147	0.432	0.456	G1NDN4.pdb.gz	G1NDN4_MELGA Fibroblast growth factor OS=Meleagris gallopavo OX=9103 GN=FGF2 PE=3 SV=3
12	PDB:3f1rA	0.781	0.771	2.009E-13	157	0.374	0.369	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
13	PDB:4jq0A	0.757	0.830	5.440E-12	141	0.271	0.298	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
14	PDB:6b0tA	0.653	0.224	3.655E-6	487	0.168	0.053	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
15	PDB:1hcdA	0.588	0.741	1.238E-4	118	0.129	0.169	1hcdA.pdb.gz
16	PDB:4qd2B	0.671	0.721	1.731E-4	143	0.090	0.098	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
17	PDB:3malA	0.579	0.503	2.165E-4	181	0.142	0.122	3malA.pdb.gz
18	PDB:7a5px	0.577	0.693	2.289E-4	125	0.116	0.144	7a5px.pdb.gz	Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.
19	PDB:1t9fA	0.668	0.588	2.863E-4	178	0.097	0.084	1t9fA.pdb.gz
20	PDB:3wmuB	0.636	0.643	3.027E-4	153	0.155	0.157	3wmuB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05230	2.17e-115	324	155	1.000	1.000	FGF1_HUMAN Fibroblast growth factor 1 OS=Homo sapiens OX=9606 GN=FGF1 PE=1 SV=1
2	P61148	3.72e-110	311	155	0.955	0.955	FGF1_MOUSE Fibroblast growth factor 1 OS=Mus musculus OX=10090 GN=Fgf1 PE=1 SV=1
3	P61149	3.72e-110	311	155	0.955	0.955	FGF1_RAT Fibroblast growth factor 1 OS=Rattus norvegicus OX=10116 GN=Fgf1 PE=1 SV=1
4	P03968	1.76e-105	299	155	0.923	0.923	FGF1_BOVIN Fibroblast growth factor 1 OS=Bos taurus OX=9913 GN=FGF1 PE=1 SV=2
5	P19596	2.25e-103	294	155	0.903	0.903	FGF1_CHICK Fibroblast growth factor 1 OS=Gallus gallus OX=9031 GN=FGF1 PE=1 SV=2
6	B3DGE3	6.43e-53	166	154	0.535	0.539	B3DGE3_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf2 PE=2 SV=1
7	P13109	8.12e-52	164	154	0.542	0.545	FGF2_RAT Fibroblast growth factor 2 OS=Rattus norvegicus OX=10116 GN=Fgf2 PE=1 SV=1
8	P48800	1.79e-51	163	158	0.535	0.525	FGF2_CHICK Fibroblast growth factor 2 OS=Gallus gallus OX=9031 GN=FGF2 PE=2 SV=1
9	A0A060Y7E5	1.90e-51	162	155	0.535	0.535	A0A060Y7E5_ONCMY Fibroblast growth factor OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00000746001 PE=3 SV=1
10	Q5FXK5	5.08e-51	162	155	0.535	0.535	Q5FXK5_ONCMY Fibroblast growth factor OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
11	P15655	1.26e-50	160	154	0.535	0.539	FGF2_MOUSE Fibroblast growth factor 2 OS=Mus musculus OX=10090 GN=Fgf2 PE=1 SV=1
12	P09038	7.86e-50	163	288	0.548	0.295	FGF2_HUMAN Fibroblast growth factor 2 OS=Homo sapiens OX=9606 GN=FGF2 PE=1 SV=3
13	P12226	2.55e-47	152	155	0.529	0.529	FGF2_XENLA Fibroblast growth factor 2 OS=Xenopus laevis OX=8355 GN=fgf2 PE=2 SV=2
14	Q6PBT8	8.82e-45	145	147	0.484	0.510	FGF1_DANRE Putative fibroblast growth factor 1 OS=Danio rerio OX=7955 GN=fgf1 PE=2 SV=1
15	G1NDN4	6.93e-41	135	147	0.432	0.456	G1NDN4_MELGA Fibroblast growth factor OS=Meleagris gallopavo OX=9103 GN=FGF2 PE=3 SV=3
16	C9JDC5	8.69e-38	125	58	0.374	1.000	C9JDC5_HUMAN Fibroblast growth factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=FGF1 PE=1 SV=1
17	B5MCF4	1.55e-36	123	93	0.374	0.624	B5MCF4_HUMAN Fibroblast growth factor 1 OS=Homo sapiens OX=9606 GN=FGF1 PE=1 SV=1
18	Q38PL0	1.68e-26	100	208	0.355	0.264	Q38PL0_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=dob PE=2 SV=1
19	Q9ESL9	4.16e-26	100	211	0.374	0.275	FGF20_MOUSE Fibroblast growth factor 20 OS=Mus musculus OX=10090 GN=Fgf20 PE=2 SV=2
20	P36364	6.85e-26	99.4	208	0.361	0.269	FGF9_RAT Fibroblast growth factor 9 OS=Rattus norvegicus OX=10116 GN=Fgf9 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06268 Fascin	0.0012	30.5	Fascin domain
2	PF00167 FGF	1.1e-39	146.7	Fibroblast growth factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008571196.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008581038.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 27 Proteins, and 92% coverage of the annotated genomic feature by RNAseq alignments
2	482537.XP_008583846.1	0.999	Fibroblast growth factor receptor 2 isoform X1
3	482537.XP_008567388.1	0.994	Fibroblast growth factor receptor 3
4	482537.XP_008574251.1	0.991	Fibroblast growth factor receptor 4 isoform X1
5	482537.XP_008565842.1	0.970	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
6	482537.XP_008564713.1	0.936	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 27 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
7	482537.XP_008585709.1	0.914	Vascular endothelial growth factor receptor 2
8	482537.XP_008578641.1	0.902	Vascular endothelial growth factor receptor 1
9	482537.XP_008568127.1	0.895	Angiopoietin-1 receptor
10	482537.XP_008570738.1	0.889	Vascular endothelial growth factor receptor 3
11	482537.XP_008577371.1	0.884	Mast/stem cell growth factor receptor Kit isoform X1
12	482537.XP_008578115.1	0.875	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 mRNAs, 7 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
13	482537.XP_008564126.1	0.870	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 21 Proteins, and 94% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
14	482537.XP_008568499.1	0.864	High affinity nerve growth factor receptor isoform X1
15	482537.XP_008573973.1	0.857	BDNF/NT-3 growth factors receptor isoform X1
16	482537.XP_008576776.1	0.855	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 20 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments
17	482537.XP_008579219.1	0.854	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 71 Proteins, and 91% coverage of the annotated genomic feature by RNAseq alignments
18	482537.XP_008588013.1	0.854	Receptor tyrosine-protein kinase erbB-2
19	482537.XP_008568488.1	0.853	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 20 Proteins, and 45% coverage of the annotated genomic feature by RNAseq alignments
20	482537.XP_008586569.1	0.850	Receptor-type tyrosine-protein kinase FLT3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0140677	0.986	molecular function activator activity
GO:0048018	0.982	receptor ligand activity
GO:0008083	0.822	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0032501	0.984	multicellular organismal process
GO:0048522	0.978	positive regulation of cellular process
GO:0032502	0.975	developmental process
GO:0042127	0.975	regulation of cell population proliferation
GO:0048731	0.974	system development
GO:0050678	0.967	regulation of epithelial cell proliferation
GO:0019222	0.963	regulation of metabolic process
GO:0008284	0.955	positive regulation of cell population proliferation
GO:0060255	0.951	regulation of macromolecule metabolic process
GO:0080090	0.949	regulation of primary metabolic process
GO:0031323	0.928	regulation of cellular metabolic process
GO:0051171	0.925	regulation of nitrogen compound metabolic process
GO:0050896	0.922	response to stimulus
GO:0050679	0.919	positive regulation of epithelial cell proliferation
GO:0009893	0.909	positive regulation of metabolic process
GO:0007154	0.871	cell communication
GO:0023052	0.863	signaling
GO:0010562	0.863	positive regulation of phosphorus metabolic process
GO:0051716	0.860	cellular response to stimulus
GO:0048513	0.851	animal organ development
GO:0045937	0.832	positive regulation of phosphate metabolic process
GO:0010604	0.830	positive regulation of macromolecule metabolic process
GO:0009888	0.822	tissue development
GO:0051239	0.806	regulation of multicellular organismal process
GO:0048583	0.806	regulation of response to stimulus
GO:0050793	0.800	regulation of developmental process
GO:0022603	0.794	regulation of anatomical structure morphogenesis
GO:0007165	0.789	signal transduction
GO:0051246	0.764	regulation of protein metabolic process
GO:0051173	0.757	positive regulation of nitrogen compound metabolic process
GO:0031399	0.752	regulation of protein modification process
GO:0009653	0.747	anatomical structure morphogenesis
GO:0023051	0.706	regulation of signaling
GO:0010646	0.704	regulation of cell communication
GO:0072359	0.688	circulatory system development
GO:0030154	0.686	cell differentiation
GO:0051094	0.685	positive regulation of developmental process
GO:0065009	0.678	regulation of molecular function
GO:0009966	0.675	regulation of signal transduction
GO:0051247	0.670	positive regulation of protein metabolic process
GO:1902531	0.651	regulation of intracellular signal transduction
GO:0042325	0.642	regulation of phosphorylation
GO:0001822	0.635	kidney development
GO:0009889	0.633	regulation of biosynthetic process
GO:0042327	0.618	positive regulation of phosphorylation
GO:0010468	0.616	regulation of gene expression
GO:0070848	0.614	response to growth factor
GO:0007167	0.610	enzyme-linked receptor protein signaling pathway
GO:0001934	0.609	positive regulation of protein phosphorylation
GO:0007507	0.599	heart development
GO:0060993	0.594	kidney morphogenesis
GO:0048584	0.580	positive regulation of response to stimulus
GO:0001823	0.572	mesonephros development
GO:0072073	0.566	kidney epithelium development
GO:0071363	0.562	cellular response to growth factor stimulus
GO:0072006	0.560	nephron development
GO:0048519	0.554	negative regulation of biological process
GO:0009967	0.554	positive regulation of signal transduction
GO:0031326	0.543	regulation of cellular biosynthetic process
GO:0002009	0.537	morphogenesis of an epithelium
GO:0035239	0.530	tube morphogenesis
GO:0010556	0.526	regulation of macromolecule biosynthetic process
GO:0072028	0.524	nephron morphogenesis
GO:0001657	0.524	ureteric bud development
GO:0030334	0.519	regulation of cell migration
GO:0060562	0.506	epithelial tube morphogenesis
GO:0044093	0.505	positive regulation of molecular function
GO:0019219	0.504	regulation of nucleobase-containing compound metabolic process
GO:0061138	0.502	morphogenesis of a branching epithelium
GO:0050790	0.493	regulation of catalytic activity
GO:0007169	0.482	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0043408	0.480	regulation of MAPK cascade
GO:0048754	0.467	branching morphogenesis of an epithelial tube
GO:0072009	0.464	nephron epithelium development
GO:0072078	0.442	nephron tubule morphogenesis
GO:0051240	0.433	positive regulation of multicellular organismal process
GO:0009891	0.415	positive regulation of biosynthetic process
GO:0048523	0.413	negative regulation of cellular process
GO:0001568	0.406	blood vessel development
GO:2000026	0.404	regulation of multicellular organismal development
GO:0060976	0.401	coronary vasculature development
GO:1902533	0.395	positive regulation of intracellular signal transduction
GO:0043410	0.371	positive regulation of MAPK cascade
GO:0010632	0.365	regulation of epithelial cell migration
GO:0051252	0.358	regulation of RNA metabolic process
GO:1901342	0.351	regulation of vasculature development
GO:0045765	0.335	regulation of angiogenesis
GO:0019216	0.328	regulation of lipid metabolic process
GO:0071774	0.323	response to fibroblast growth factor
GO:1904018	0.304	positive regulation of vasculature development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0070013	0.996	intracellular organelle lumen
GO:0005615	0.993	extracellular space
GO:0005654	0.989	nucleoplasm
GO:0071944	0.987	cell periphery
GO:0005829	0.944	cytosol
GO:0005886	0.921	plasma membrane
GO:0043232	0.801	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]