StarFunc result for job id P05231

User Input

>input (212 residues)
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05231	1.000	1.000	5.345E-28	212	1.000	1.000	P05231.pdb.gz	IL6_HUMAN Interleukin-6 OS=Homo sapiens OX=9606 GN=IL6 PE=1 SV=1
2	PDB:4cniC	0.790	0.976	7.932E-21	171	0.807	1.000	4cniC.pdb.gz
3	AFDB:P26893	0.745	0.745	1.006E-17	212	0.613	0.613	P26893.pdb.gz	IL6_PIG Interleukin-6 OS=Sus scrofa OX=9823 GN=IL6 PE=2 SV=2
4	AFDB:P08505	0.718	0.721	2.675E-14	211	0.415	0.417	P08505.pdb.gz	IL6_MOUSE Interleukin-6 OS=Mus musculus OX=10090 GN=Il6 PE=1 SV=1
5	PDB:4zs7A	0.606	0.902	4.870E-14	139	0.656	1.000	4zs7A.pdb.gz
6	AFDB:P20607	0.731	0.735	7.211E-14	211	0.410	0.412	P20607.pdb.gz	IL6_RAT Interleukin-6 OS=Rattus norvegicus OX=10116 GN=Il6 PE=2 SV=1
7	AFDB:B7TXY8	0.649	0.661	1.285E-12	208	0.495	0.505	B7TXY8.pdb.gz	B7TXY8_SHEEP Interleukin-6 OS=Ovis aries OX=9940 PE=3 SV=1
8	AFDB:Q90YI0	0.740	0.653	7.375E-12	241	0.363	0.320	Q90YI0.pdb.gz	IL6_CHICK Interleukin-6 OS=Gallus gallus OX=9031 GN=IL6 PE=2 SV=1
9	AFDB:M5EF24	0.600	0.582	3.335E-7	219	0.217	0.210	M5EF24.pdb.gz	M5EF24_ONCMY Interleukin-6 OS=Oncorhynchus mykiss OX=8022 GN=IL6 PE=3 SV=1
10	PDB:2l3yA	0.594	0.669	4.412E-6	184	0.340	0.391	2l3yA.pdb.gz
11	AFDB:H9A0J9	0.584	0.539	4.921E-6	231	0.189	0.173	H9A0J9.pdb.gz	H9A0J9_DANRE Interleukin-6 OS=Danio rerio OX=7955 GN=il6 PE=2 SV=1
12	AFDB:P09920	0.614	0.625	5.734E-5	208	0.151	0.154	P09920.pdb.gz	CSF3_MOUSE Granulocyte colony-stimulating factor OS=Mus musculus OX=10090 GN=Csf3 PE=1 SV=1
13	AFDB:P09919	0.606	0.620	9.639E-5	207	0.137	0.140	P09919.pdb.gz	CSF3_HUMAN Granulocyte colony-stimulating factor OS=Homo sapiens OX=9606 GN=CSF3 PE=1 SV=1
14	PDB:1rhgB	0.561	0.798	1.615E-3	144	0.127	0.188	1rhgB.pdb.gz
15	PDB:7u7nD	0.440	0.476	5.259E-3	191	0.165	0.183	7u7nD.pdb.gz
16	PDB:7z0lB	0.428	0.266	5.780E-3	370	0.137	0.078	7z0lB.pdb.gz
17	PDB:1f6fA	0.447	0.495	2.168E-2	183	0.104	0.120	1f6fA.pdb.gz
18	PDB:3d48P	0.540	0.674	2.273E-2	165	0.127	0.164	3d48P.pdb.gz	Crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor
19	PDB:7zxkC	0.430	0.514	2.746E-2	166	0.160	0.205	7zxkC.pdb.gz
20	PDB:3duhC	0.423	0.626	2.879E-2	137	0.146	0.226	3duhC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05231	5.36e-158	437	212	1.000	1.000	IL6_HUMAN Interleukin-6 OS=Homo sapiens OX=9606 GN=IL6 PE=1 SV=1
2	P26893	1.12e-90	266	212	0.613	0.613	IL6_PIG Interleukin-6 OS=Sus scrofa OX=9823 GN=IL6 PE=2 SV=2
3	B7TXY8	2.68e-74	225	208	0.524	0.534	B7TXY8_SHEEP Interleukin-6 OS=Ovis aries OX=9940 PE=3 SV=1
4	P29455	2.68e-74	225	208	0.524	0.534	IL6_SHEEP Interleukin-6 OS=Ovis aries OX=9940 GN=IL6 PE=2 SV=2
5	P20607	8.84e-55	175	211	0.410	0.412	IL6_RAT Interleukin-6 OS=Rattus norvegicus OX=10116 GN=Il6 PE=2 SV=1
6	P08505	1.53e-53	172	211	0.410	0.412	IL6_MOUSE Interleukin-6 OS=Mus musculus OX=10090 GN=Il6 PE=1 SV=1
7	Q90YI0	8.03e-39	135	241	0.321	0.282	IL6_CHICK Interleukin-6 OS=Gallus gallus OX=9031 GN=IL6 PE=2 SV=1
8	Q2HRC7	4.45e-17	78.2	204	0.193	0.201	VIL6_HHV8P Viral interleukin-6 homolog OS=Human herpesvirus 8 type P (isolate GK18) OX=868565 GN=K2 PE=1 SV=1
9	Q0GGL7	5.59e-06	47.8	219	0.137	0.132	IL6_ONCMY Interleukin-6 OS=Oncorhynchus mykiss OX=8022 GN=il6 PE=2 SV=1
10	E3Q1F7	9.06e-06	47.0	199	0.132	0.141	E3Q1F7_ONCMY Interleukin-6 (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=il6 PE=2 SV=1
11	M5EF24	9.73e-06	47.0	219	0.132	0.128	M5EF24_ONCMY Interleukin-6 OS=Oncorhynchus mykiss OX=8022 GN=IL6 PE=3 SV=1
12	P09920	0.001	40.8	208	0.127	0.130	CSF3_MOUSE Granulocyte colony-stimulating factor OS=Mus musculus OX=10090 GN=Csf3 PE=1 SV=1
13	H9A0J9	0.017	37.4	231	0.226	0.208	H9A0J9_DANRE Interleukin-6 OS=Danio rerio OX=7955 GN=il6 PE=2 SV=1
14	Q8N4W3	0.48	33.1	200	0.085	0.090	Q8N4W3_HUMAN Granulocyte colony-stimulating factor OS=Homo sapiens OX=9606 GN=CSF3 PE=1 SV=1
15	P97712	1.6	31.6	214	0.085	0.084	P97712_RAT Granulocyte colony-stimulating factor OS=Rattus norvegicus OX=10116 GN=Csf3 PE=2 SV=1
16	F7FGY7	2.1	31.2	208	0.085	0.087	F7FGY7_RAT Granulocyte colony-stimulating factor OS=Rattus norvegicus OX=10116 GN=Csf3 PE=3 SV=1
17	A0A8I6AAV9	2.4	30.8	203	0.085	0.089	A0A8I6AAV9_RAT Granulocyte colony-stimulating factor OS=Rattus norvegicus OX=10116 GN=Csf3 PE=3 SV=1
18	Q9VC64	2.5	31.6	1729	0.118	0.014	Q9VC64_DROME Anastral spindle 1, isoform A OS=Drosophila melanogaster OX=7227 GN=ana1 PE=1 SV=1
19	Q75JC5	3.5	30.8	344	0.085	0.052	Q75JC5_DICDI Short-chain dehydrogenase/reductase family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271820 PE=4 SV=1
20	P06668	3.6	30.8	424	0.075	0.038	VIRD2_RHIRD T-DNA border endonuclease VirD2 OS=Rhizobium radiobacter OX=358 GN=virD2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16647 GCSF	75	14.6	Granulocyte colony-stimulating factor
2	PF07400 IL11	0.96	20.6	Interleukin 11
3	PF16649 IL23	24	16.5	Interleukin 23 subunit alpha
4	PF00489 IL6	9.7e-79	274.8	Interleukin-6/G-CSF/MGF family
5	PF02899 Phage_int_SAM_1	36	16.0	Phage integrase, N-terminal SAM-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385675

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357470	0.999	Interleukin-6 receptor subunit alpha
2	9606.ENSP00000370698	0.999	Interleukin-6 receptor subunit beta
3	9606.ENSP00000263341	0.997	Interleukin-1 beta
4	9606.ENSP00000306512	0.997	Interleukin-8
5	9606.ENSP00000379110	0.996	Growth-regulated alpha protein
6	9606.ENSP00000427279	0.995	C-X-C motif chemokine 2
7	9606.ENSP00000225831	0.994	C-C motif chemokine 2
8	9606.ENSP00000344192	0.994	Interleukin-17A
9	9606.ENSP00000398698	0.994	Tumor necrosis factor
10	9606.ENSP00000263339	0.993	Interleukin-1 alpha
11	9606.ENSP00000264657	0.992	Signal transducer and activator of transcription 3
12	9606.ENSP00000231449	0.991	Interleukin-4
13	9606.ENSP00000296871	0.991	Granulocyte-macrophage colony-stimulating factor
14	9606.ENSP00000221930	0.990	Transforming growth factor beta-1
15	9606.ENSP00000225474	0.990	Granulocyte colony-stimulating factor
16	9606.ENSP00000305651	0.989	C-X-C motif chemokine 10
17	9606.ENSP00000371067	0.989	Tyrosine-protein kinase JAK2
18	9606.ENSP00000477908	0.989	C-C motif chemokine 3
19	9606.ENSP00000280357	0.988	Interleukin-18
20	9606.ENSP00000474412	0.988	C-C motif chemokine 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005138	1.000	interleukin-6 receptor binding
GO:0005125	1.000	cytokine activity
GO:0008083	0.998	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0051716	0.992	cellular response to stimulus
GO:0051239	0.991	regulation of multicellular organismal process
GO:0048518	0.991	positive regulation of biological process
GO:0010033	0.983	response to organic substance
GO:0048522	0.983	positive regulation of cellular process
GO:0051240	0.979	positive regulation of multicellular organismal process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0034097	0.967	response to cytokine
GO:0009605	0.965	response to external stimulus
GO:0002682	0.962	regulation of immune system process
GO:0048583	0.961	regulation of response to stimulus
GO:0071704	0.957	organic substance metabolic process
GO:0071310	0.957	cellular response to organic substance
GO:0048519	0.954	negative regulation of biological process
GO:0009893	0.951	positive regulation of metabolic process
GO:0051171	0.950	regulation of nitrogen compound metabolic process
GO:0032496	0.947	response to lipopolysaccharide
GO:0080090	0.946	regulation of primary metabolic process
GO:0071222	0.942	cellular response to lipopolysaccharide
GO:0045785	0.939	positive regulation of cell adhesion
GO:0022407	0.937	regulation of cell-cell adhesion
GO:1902531	0.936	regulation of intracellular signal transduction
GO:0043170	0.934	macromolecule metabolic process
GO:0001817	0.932	regulation of cytokine production
GO:0031323	0.931	regulation of cellular metabolic process
GO:0010604	0.931	positive regulation of macromolecule metabolic process
GO:0071345	0.931	cellular response to cytokine stimulus
GO:0032501	0.927	multicellular organismal process
GO:0050870	0.926	positive regulation of T cell activation
GO:0002376	0.919	immune system process
GO:0007154	0.916	cell communication
GO:0019219	0.914	regulation of nucleobase-containing compound metabolic process
GO:0071354	0.912	cellular response to interleukin-6
GO:0048523	0.906	negative regulation of cellular process
GO:0048584	0.899	positive regulation of response to stimulus
GO:0006950	0.896	response to stress
GO:0023056	0.894	positive regulation of signaling
GO:0010647	0.894	positive regulation of cell communication
GO:0051173	0.885	positive regulation of nitrogen compound metabolic process
GO:0031325	0.884	positive regulation of cellular metabolic process
GO:0006955	0.868	immune response
GO:0001932	0.868	regulation of protein phosphorylation
GO:0023052	0.866	signaling
GO:0031328	0.865	positive regulation of cellular biosynthetic process
GO:0032101	0.863	regulation of response to external stimulus
GO:0008284	0.857	positive regulation of cell population proliferation
GO:0007165	0.856	signal transduction
GO:0009967	0.855	positive regulation of signal transduction
GO:0065009	0.838	regulation of molecular function
GO:0010605	0.833	negative regulation of macromolecule metabolic process
GO:0010628	0.829	positive regulation of gene expression
GO:0050793	0.826	regulation of developmental process
GO:0007166	0.822	cell surface receptor signaling pathway
GO:0006952	0.821	defense response
GO:0010941	0.820	regulation of cell death
GO:0042327	0.820	positive regulation of phosphorylation
GO:0051241	0.810	negative regulation of multicellular organismal process
GO:0010556	0.809	regulation of macromolecule biosynthetic process
GO:0048585	0.805	negative regulation of response to stimulus
GO:0051252	0.805	regulation of RNA metabolic process
GO:0031401	0.805	positive regulation of protein modification process
GO:0006355	0.793	regulation of DNA-templated transcription
GO:1903706	0.780	regulation of hemopoiesis
GO:0042981	0.774	regulation of apoptotic process
GO:0014070	0.750	response to organic cyclic compound
GO:0065008	0.745	regulation of biological quality
GO:0032879	0.744	regulation of localization
GO:1904892	0.741	regulation of receptor signaling pathway via STAT
GO:0032502	0.730	developmental process
GO:0051049	0.715	regulation of transport
GO:0046425	0.712	regulation of receptor signaling pathway via JAK-STAT
GO:0051094	0.707	positive regulation of developmental process
GO:1904894	0.706	positive regulation of receptor signaling pathway via STAT
GO:0050864	0.692	regulation of B cell activation
GO:0050730	0.680	regulation of peptidyl-tyrosine phosphorylation
GO:0050871	0.680	positive regulation of B cell activation
GO:0080134	0.675	regulation of response to stress
GO:0042509	0.654	regulation of tyrosine phosphorylation of STAT protein
GO:1903530	0.645	regulation of secretion by cell
GO:0045597	0.629	positive regulation of cell differentiation
GO:0001775	0.621	cell activation
GO:0010629	0.618	negative regulation of gene expression
GO:0048856	0.615	anatomical structure development
GO:0044093	0.599	positive regulation of molecular function
GO:0044238	0.579	primary metabolic process
GO:0045935	0.578	positive regulation of nucleobase-containing compound metabolic process
GO:0033138	0.570	positive regulation of peptidyl-serine phosphorylation
GO:0006807	0.528	nitrogen compound metabolic process
GO:0010557	0.389	positive regulation of macromolecule biosynthetic process
GO:0044237	0.375	cellular metabolic process
GO:0051172	0.361	negative regulation of nitrogen compound metabolic process
GO:0007275	0.336	multicellular organism development
GO:0051128	0.321	regulation of cellular component organization
GO:0046883	0.312	regulation of hormone secretion
GO:1901564	0.303	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005622	0.965	intracellular anatomical structure
GO:0071944	0.961	cell periphery
GO:0005737	0.947	cytoplasm
GO:0016020	0.918	membrane
GO:0043226	0.877	organelle
GO:0043227	0.868	membrane-bounded organelle
GO:0043231	0.856	intracellular membrane-bounded organelle
GO:0032991	0.773	protein-containing complex
GO:0031974	0.720	membrane-enclosed lumen
GO:0005886	0.713	plasma membrane
GO:0070013	0.712	intracellular organelle lumen
GO:0012505	0.666	endomembrane system
GO:0098796	0.580	membrane protein complex
GO:0098802	0.502	plasma membrane signaling receptor complex
GO:0005788	0.491	endoplasmic reticulum lumen
GO:0031981	0.367	nuclear lumen
GO:0005896	0.366	interleukin-6 receptor complex
GO:0005654	0.334	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]