StarFunc result for job id P05305

User Input

>input (212 residues)
MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCW
NFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSE
TMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05305	1.000	1.000	3.127E-36	212	1.000	1.000	P05305.pdb.gz	EDN1_HUMAN Endothelin-1 OS=Homo sapiens OX=9606 GN=EDN1 PE=1 SV=1
2	AFDB:P22387	0.225	0.235	1.255E-20	202	0.698	0.733	P22387.pdb.gz	EDN1_MOUSE Endothelin-1 OS=Mus musculus OX=10090 GN=Edn1 PE=1 SV=3
3	AFDB:E9QFS0	0.211	0.276	1.250E-7	153	0.245	0.340	E9QFS0.pdb.gz	E9QFS0_DANRE Endothelin 3b OS=Danio rerio OX=7955 GN=EDN3 PE=2 SV=1
4	AFDB:P13207	0.187	0.219	6.417E-7	167	0.236	0.299	P13207.pdb.gz	EDN3_RAT Endothelin-3 OS=Rattus norvegicus OX=10116 GN=Edn3 PE=2 SV=3
5	AFDB:P14138	0.203	0.189	1.289E-5	238	0.245	0.218	P14138.pdb.gz	EDN3_HUMAN Endothelin-3 OS=Homo sapiens OX=9606 GN=EDN3 PE=1 SV=1
6	AFDB:A7T4J9	0.174	0.171	1.196E-1	217	0.151	0.147	A7T4J9.pdb.gz	A7T4J9_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g248713 PE=1 SV=1
7	AFDB:Q04635	0.200	0.116	1.681E-1	413	0.151	0.077	Q04635.pdb.gz	ESC1_SCHPO Protein esc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=esc1 PE=2 SV=1
8	AFDB:P36103	0.198	0.154	2.364E-1	277	0.127	0.097	P36103.pdb.gz	YKC3_YEAST Uncharacterized protein YKL023W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YKL023W PE=1 SV=2
9	AFDB:A0A024R1X5	0.202	0.101	3.325E-1	450	0.142	0.067	A0A024R1X5.pdb.gz	A0A024R1X5_HUMAN Beclin-1 OS=Homo sapiens OX=9606 GN=BECN1 PE=2 SV=1
10	AFDB:Q9SYG2	0.200	0.116	3.325E-1	383	0.142	0.078	Q9SYG2.pdb.gz	ASIL1_ARATH Trihelix transcription factor ASIL1 OS=Arabidopsis thaliana OX=3702 GN=ASIL1 PE=1 SV=1
11	PDB:6t9iI	0.184	0.218	3.027	173	0.108	0.133	6t9iI.pdb.gz
12	PDB:3j79F	0.194	0.109	3.240	390	0.061	0.033	3j79F.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
13	PDB:5mpsK	0.133	0.150	3.975	187	0.066	0.075	5mpsK.pdb.gz	Structure of a spliceosome remodelled for exon ligation.
14	PDB:5dgeSM	0.093	0.115	5.985	159	0.118	0.157	5dgeSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
15	PDB:7w59R	0.123	0.098	6.859	280	0.113	0.086	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
16	PDB:7mq9SI	0.146	0.045	8.415	844	0.113	0.028	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7wtpCC	0.114	0.040	8.415	661	0.057	0.018	7wtpCC.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
18	PDB:7wtrCC	0.104	0.039	8.415	615	0.057	0.020	7wtrCC.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
19	PDB:7dcoL	0.180	0.094	9.644	435	0.075	0.037	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05305	1.34e-160	443	212	1.000	1.000	EDN1_HUMAN Endothelin-1 OS=Homo sapiens OX=9606 GN=EDN1 PE=1 SV=1
2	P22387	3.71e-102	295	202	0.698	0.733	EDN1_MOUSE Endothelin-1 OS=Mus musculus OX=10090 GN=Edn1 PE=1 SV=3
3	P22388	1.84e-98	286	202	0.684	0.718	EDN1_RAT Endothelin-1 OS=Rattus norvegicus OX=10116 GN=Edn1 PE=1 SV=2
4	Q9I8G3	2.40e-30	112	188	0.307	0.346	Q9I8G3_DANRE Endothelin 1 OS=Danio rerio OX=7955 GN=et-1 PE=2 SV=1
5	E9QFS0	1.55e-23	93.6	153	0.255	0.353	E9QFS0_DANRE Endothelin 3b OS=Danio rerio OX=7955 GN=EDN3 PE=2 SV=1
6	P20800	1.77e-20	86.7	178	0.193	0.230	EDN2_HUMAN Endothelin-2 OS=Homo sapiens OX=9606 GN=EDN2 PE=1 SV=2
7	P14138	4.35e-20	87.0	238	0.245	0.218	EDN3_HUMAN Endothelin-3 OS=Homo sapiens OX=9606 GN=EDN3 PE=1 SV=1
8	P23943	2.35e-19	83.6	176	0.189	0.227	EDN2_RAT Endothelin-2 OS=Rattus norvegicus OX=10116 GN=Edn2 PE=2 SV=2
9	P13207	7.52e-19	82.0	167	0.184	0.234	EDN3_RAT Endothelin-3 OS=Rattus norvegicus OX=10116 GN=Edn3 PE=2 SV=3
10	P48299	1.01e-18	82.8	214	0.184	0.182	EDN3_MOUSE Endothelin-3 OS=Mus musculus OX=10090 GN=Edn3 PE=2 SV=1
11	P22389	1.71e-17	78.6	175	0.189	0.229	EDN2_MOUSE Endothelin-2 OS=Mus musculus OX=10090 GN=Edn2 PE=2 SV=3
12	Q96BN8	3.1	30.8	352	0.094	0.057	OTUL_HUMAN Ubiquitin thioesterase otulin OS=Homo sapiens OX=9606 GN=OTULIN PE=1 SV=3
13	F4HTH8	3.3	31.2	1181	0.061	0.011	KTN82_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2 OS=Arabidopsis thaliana OX=3702 GN=KTN80.2 PE=1 SV=1
14	A0A087WUV1	3.9	30.0	141	0.066	0.099	A0A087WUV1_HUMAN Cilia- and flagella-associated protein 45 (Fragment) OS=Homo sapiens OX=9606 GN=CFAP45 PE=1 SV=1
15	Q6PW01	3.9	30.8	398	0.047	0.025	Q6PW01_DANRE Cytohesin 1-like protein OS=Danio rerio OX=7955 GN=cyth1 PE=2 SV=1
16	Q6PC26	4.9	30.4	399	0.052	0.028	Q6PC26_DANRE Cytohesin-1 OS=Danio rerio OX=7955 GN=zgc:73134 PE=2 SV=1
17	E7F2Q0	5.1	30.4	396	0.047	0.025	E7F2Q0_DANRE Cytohesin 3a OS=Danio rerio OX=7955 GN=cyth3a PE=4 SV=1
18	Q15438	5.4	30.4	398	0.047	0.025	CYH1_HUMAN Cytohesin-1 OS=Homo sapiens OX=9606 GN=CYTH1 PE=1 SV=1
19	P97694	5.6	30.0	398	0.047	0.025	CYH1_RAT Cytohesin-1 OS=Rattus norvegicus OX=10116 GN=Cyth1 PE=1 SV=1
20	Q9QX11	5.6	30.0	398	0.047	0.025	CYH1_MOUSE Cytohesin-1 OS=Mus musculus OX=10090 GN=Cyth1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00322 Endothelin	5.2e-20	81.9	Endothelin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368683

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315011	0.999	Endothelin-1 receptor
2	9606.ENSP00000366416	0.999	Endothelin receptor type B
3	9606.ENSP00000364028	0.987	Endothelin-converting enzyme 1
4	9606.ENSP00000355627	0.981	Angiotensinogen
5	9606.ENSP00000451828	0.966	RAC-alpha serine/threonine-protein kinase
6	9606.ENSP00000265171	0.963	Pro-epidermal growth factor
7	9606.ENSP00000286548	0.963	Guanine nucleotide-binding protein G(q) subunit alpha
8	9606.ENSP00000437955	0.962	Hypoxia-inducible factor 1-alpha
9	9606.ENSP00000263025	0.960	Mitogen-activated protein kinase 3
10	9606.ENSP00000400175	0.960	Transforming protein RhoA
11	9606.ENSP00000360266	0.959	Transcription factor AP-1
12	9606.ENSP00000334458	0.953	Transcription factor GATA-4
13	9606.ENSP00000362680	0.953	Proto-oncogene tyrosine-protein kinase Src
14	9606.ENSP00000443631	0.953	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
15	9606.ENSP00000308541	0.951	Prothrombin
16	9606.ENSP00000263980	0.949	Sodium/hydrogen exchanger 1
17	9606.ENSP00000360973	0.948	Type-2 angiotensin II receptor
18	9606.ENSP00000275493	0.947	Epidermal growth factor receptor
19	9606.ENSP00000379140	0.944	Stromal cell-derived factor 1
20	9606.ENSP00000385523	0.944	Peroxisome proliferator-activated receptor alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031707	1.000	endothelin A receptor binding
GO:0005179	1.000	hormone activity
GO:0005125	1.000	cytokine activity
GO:0031708	0.994	endothelin B receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.973	cellular process
GO:0032501	0.969	multicellular organismal process
GO:0050896	0.966	response to stimulus
GO:0044057	0.965	regulation of system process
GO:0008284	0.961	positive regulation of cell population proliferation
GO:0051047	0.958	positive regulation of secretion
GO:0044238	0.951	primary metabolic process
GO:0035556	0.951	intracellular signal transduction
GO:0048856	0.947	anatomical structure development
GO:0051246	0.945	regulation of protein metabolic process
GO:0044237	0.939	cellular metabolic process
GO:0051179	0.938	localization
GO:0006950	0.932	response to stress
GO:0071704	0.931	organic substance metabolic process
GO:0006810	0.928	transport
GO:0008217	0.921	regulation of blood pressure
GO:0007275	0.920	multicellular organism development
GO:0043085	0.920	positive regulation of catalytic activity
GO:0023051	0.916	regulation of signaling
GO:0010646	0.912	regulation of cell communication
GO:0071702	0.901	organic substance transport
GO:0048519	0.899	negative regulation of biological process
GO:0007204	0.899	positive regulation of cytosolic calcium ion concentration
GO:0042221	0.896	response to chemical
GO:0051240	0.892	positive regulation of multicellular organismal process
GO:0071310	0.890	cellular response to organic substance
GO:0009892	0.889	negative regulation of metabolic process
GO:0046903	0.888	secretion
GO:0048523	0.886	negative regulation of cellular process
GO:0051094	0.878	positive regulation of developmental process
GO:0031323	0.878	regulation of cellular metabolic process
GO:0009893	0.878	positive regulation of metabolic process
GO:1902533	0.876	positive regulation of intracellular signal transduction
GO:0007166	0.872	cell surface receptor signaling pathway
GO:0006939	0.866	smooth muscle contraction
GO:1903530	0.864	regulation of secretion by cell
GO:0090257	0.862	regulation of muscle system process
GO:0010604	0.862	positive regulation of macromolecule metabolic process
GO:0006355	0.855	regulation of DNA-templated transcription
GO:0031325	0.853	positive regulation of cellular metabolic process
GO:0051173	0.851	positive regulation of nitrogen compound metabolic process
GO:0006874	0.850	intracellular calcium ion homeostasis
GO:0010817	0.846	regulation of hormone levels
GO:0030334	0.843	regulation of cell migration
GO:0045937	0.842	positive regulation of phosphate metabolic process
GO:1901700	0.827	response to oxygen-containing compound
GO:0001932	0.825	regulation of protein phosphorylation
GO:0030335	0.821	positive regulation of cell migration
GO:0071840	0.816	cellular component organization or biogenesis
GO:0051247	0.814	positive regulation of protein metabolic process
GO:0009653	0.806	anatomical structure morphogenesis
GO:0031328	0.805	positive regulation of cellular biosynthetic process
GO:0016043	0.804	cellular component organization
GO:0010605	0.788	negative regulation of macromolecule metabolic process
GO:1903532	0.769	positive regulation of secretion by cell
GO:0007267	0.745	cell-cell signaling
GO:0044249	0.741	cellular biosynthetic process
GO:1901576	0.737	organic substance biosynthetic process
GO:0080134	0.734	regulation of response to stress
GO:0032101	0.733	regulation of response to external stimulus
GO:0097746	0.731	blood vessel diameter maintenance
GO:0048731	0.724	system development
GO:0006937	0.720	regulation of muscle contraction
GO:0007186	0.712	G protein-coupled receptor signaling pathway
GO:0046883	0.692	regulation of hormone secretion
GO:1903522	0.680	regulation of blood circulation
GO:0044281	0.675	small molecule metabolic process
GO:0048513	0.674	animal organ development
GO:0050878	0.673	regulation of body fluid levels
GO:0071495	0.669	cellular response to endogenous stimulus
GO:0030154	0.665	cell differentiation
GO:0006940	0.647	regulation of smooth muscle contraction
GO:0045933	0.647	positive regulation of muscle contraction
GO:0010941	0.646	regulation of cell death
GO:0003073	0.645	regulation of systemic arterial blood pressure
GO:0050886	0.640	endocrine process
GO:0042310	0.640	vasoconstriction
GO:0045987	0.633	positive regulation of smooth muscle contraction
GO:0008016	0.628	regulation of heart contraction
GO:0001990	0.609	regulation of systemic arterial blood pressure by hormone
GO:0045935	0.602	positive regulation of nucleobase-containing compound metabolic process
GO:0048468	0.596	cell development
GO:0010557	0.592	positive regulation of macromolecule biosynthetic process
GO:0034762	0.587	regulation of transmembrane transport
GO:0019229	0.561	regulation of vasoconstriction
GO:1901701	0.559	cellular response to oxygen-containing compound
GO:0009790	0.543	embryo development
GO:0045823	0.536	positive regulation of heart contraction
GO:0051172	0.531	negative regulation of nitrogen compound metabolic process
GO:0051128	0.473	regulation of cellular component organization
GO:0006807	0.429	nitrogen compound metabolic process
GO:0002376	0.366	immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005615	1.000	extracellular space
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0031410	0.978	cytoplasmic vesicle
GO:0071944	0.533	cell periphery
GO:0070013	0.508	intracellular organelle lumen
GO:0016020	0.466	membrane
GO:0005886	0.429	plasma membrane
GO:0030133	0.333	transport vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]