StarFunc result for job id P05362

User Input

>input (532 residues)
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05362	1.000	1.000	3.977E-92	532	1.000	1.000	P05362.pdb.gz	ICAM1_HUMAN Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2
2	AFDB:P13597	0.672	0.666	2.988E-57	537	0.524	0.520	P13597.pdb.gz	ICAM1_MOUSE Intercellular adhesion molecule 1 OS=Mus musculus OX=10090 GN=Icam1 PE=1 SV=1
3	AFDB:P32942	0.845	0.822	4.584E-57	547	0.468	0.455	P32942.pdb.gz	ICAM3_HUMAN Intercellular adhesion molecule 3 OS=Homo sapiens OX=9606 GN=ICAM3 PE=1 SV=2
4	AFDB:Q00238	0.629	0.617	1.029E-56	545	0.509	0.497	Q00238.pdb.gz	ICAM1_RAT Intercellular adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Icam1 PE=2 SV=1
5	AFDB:Q60625	0.704	0.429	1.495E-51	917	0.430	0.250	Q60625.pdb.gz	ICAM5_MOUSE Intercellular adhesion molecule 5 OS=Mus musculus OX=10090 GN=Icam5 PE=1 SV=2
6	AFDB:Q9UMF0	0.758	0.452	3.050E-51	924	0.445	0.256	Q9UMF0.pdb.gz	ICAM5_HUMAN Intercellular adhesion molecule 5 OS=Homo sapiens OX=9606 GN=ICAM5 PE=1 SV=3
7	AFDB:P29533	0.314	0.235	9.804E-22	739	0.222	0.160	P29533.pdb.gz	VCAM1_MOUSE Vascular cell adhesion protein 1 OS=Mus musculus OX=10090 GN=Vcam1 PE=1 SV=1
8	AFDB:P29534	0.270	0.206	5.178E-21	739	0.197	0.142	P29534.pdb.gz	VCAM1_RAT Vascular cell adhesion protein 1 OS=Rattus norvegicus OX=10116 GN=Vcam1 PE=1 SV=1
9	AFDB:P19320	0.293	0.221	1.218E-20	739	0.197	0.142	P19320.pdb.gz	VCAM1_HUMAN Vascular cell adhesion protein 1 OS=Homo sapiens OX=9606 GN=VCAM1 PE=1 SV=1
10	AFDB:Q9QZS7	0.319	0.157	3.468E-20	1256	0.171	0.072	Q9QZS7.pdb.gz	NPHN_MOUSE Nephrin OS=Mus musculus OX=10090 GN=Nphs1 PE=1 SV=2
11	PDB:5oj2B	0.226	0.178	2.120E-15	692	0.156	0.120	5oj2B.pdb.gz
12	PDB:1e07A	0.339	0.295	2.635E-14	642	0.132	0.109	1e07A.pdb.gz
13	PDB:7bg7B	0.153	0.933	1.915E-10	84	0.156	0.988	7bg7B.pdb.gz
14	PDB:5a42A	0.147	0.062	6.591E-10	1597	0.128	0.043	5a42A.pdb.gz
15	PDB:7q1yA	0.142	0.072	7.972E-10	1374	0.128	0.049	7q1yA.pdb.gz
16	PDB:4aq1A	0.160	0.130	1.627E-9	721	0.124	0.092	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
17	PDB:7sqcO0	0.226	0.140	3.165E-9	1140	0.126	0.059	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:1hzhH	0.166	0.182	4.630E-9	457	0.124	0.144	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
19	PDB:6h03A	0.203	0.110	6.458E-9	1223	0.107	0.047	6h03A.pdb.gz
20	PDB:1igtB	0.187	0.214	7.103E-9	444	0.137	0.164	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05362	0.0	1079	532	1.000	1.000	ICAM1_HUMAN Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2
2	P13597	0.0	530	537	0.539	0.534	ICAM1_MOUSE Intercellular adhesion molecule 1 OS=Mus musculus OX=10090 GN=Icam1 PE=1 SV=1
3	Q5NKV8	0.0	1075	532	0.996	0.996	Q5NKV8_HUMAN Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=2 SV=1
4	Q00238	1.37e-170	495	545	0.530	0.517	ICAM1_RAT Intercellular adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Icam1 PE=2 SV=1
5	P32942	2.40e-154	454	547	0.468	0.455	ICAM3_HUMAN Intercellular adhesion molecule 3 OS=Homo sapiens OX=9606 GN=ICAM3 PE=1 SV=2
6	Q9UMF0	1.68e-135	417	924	0.427	0.246	ICAM5_HUMAN Intercellular adhesion molecule 5 OS=Homo sapiens OX=9606 GN=ICAM5 PE=1 SV=3
7	Q60625	3.18e-132	408	917	0.412	0.239	ICAM5_MOUSE Intercellular adhesion molecule 5 OS=Mus musculus OX=10090 GN=Icam5 PE=1 SV=2
8	P13598	1.14e-23	102	275	0.141	0.273	ICAM2_HUMAN Intercellular adhesion molecule 2 OS=Homo sapiens OX=9606 GN=ICAM2 PE=1 SV=2
9	P35330	3.12e-19	90.1	277	0.132	0.253	ICAM2_MOUSE Intercellular adhesion molecule 2 OS=Mus musculus OX=10090 GN=Icam2 PE=1 SV=1
10	B8JHX2	1.11e-08	59.3	360	0.128	0.189	B8JHX2_DANRE Intercellular adhesion molecule 3 OS=Danio rerio OX=7955 GN=si:ch211-74m13.3 PE=3 SV=1
11	Q14773	4.78e-06	50.4	271	0.083	0.162	ICAM4_HUMAN Intercellular adhesion molecule 4 OS=Homo sapiens OX=9606 GN=ICAM4 PE=1 SV=1
12	A0A0B4LEH1	7.59e-05	48.1	1492	0.141	0.050	A0A0B4LEH1_DROME Sticks and stones, isoform C OS=Drosophila melanogaster OX=7227 GN=sns PE=4 SV=1
13	A1Z7J1	9.23e-05	47.8	1479	0.141	0.051	A1Z7J1_DROME Sticks and stones, isoform A OS=Drosophila melanogaster OX=7227 GN=sns PE=4 SV=1
14	Q0E9F2	9.36e-05	47.8	1542	0.141	0.049	Q0E9F2_DROME Sticks and stones, isoform B OS=Drosophila melanogaster OX=7227 GN=sns PE=1 SV=1
15	Q9V4Y0	9.48e-05	47.8	1482	0.141	0.051	Q9V4Y0_DROME SNS OS=Drosophila melanogaster OX=7227 GN=sns PE=2 SV=2
16	D3YXG0	2.51e-04	46.6	5634	0.105	0.010	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
17	P29533	2.51e-04	46.2	739	0.164	0.118	VCAM1_MOUSE Vascular cell adhesion protein 1 OS=Mus musculus OX=10090 GN=Vcam1 PE=1 SV=1
18	Q7JXW8	0.001	43.5	433	0.043	0.053	Q7JXW8_DROME Off-track2 OS=Drosophila melanogaster OX=7227 GN=otk2 PE=2 SV=1
19	E7F3V2	0.002	43.5	4212	0.113	0.014	E7F3V2_DANRE Hemicentin 2 OS=Danio rerio OX=7955 GN=hmcn2 PE=1 SV=2
20	Q8NDA2	0.002	43.5	5059	0.094	0.010	HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens OX=9606 GN=HMCN2 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09085 Adhes-Ig_like	44	15.6	Adhesion molecule, immunoglobulin-like
2	PF07654 C1-set	48	15.7	Immunoglobulin C1-set domain
3	PF08205 C2-set_2	0.11	23.9	CD80-like C2-set immunoglobulin domain
4	PF07679 I-set	21	16.6	Immunoglobulin I-set domain
5	PF03921 ICAM_N	2.9e-36	134.3	Intercellular adhesion molecule (ICAM), N-terminal domain
6	PF00047 ig	0.0061	28.0	Immunoglobulin domain
7	PF13895 Ig_2	1.7e-13	62.0	Immunoglobulin domain
8	PF13927 Ig_3	0.0013	30.6	Immunoglobulin domain
9	PF07686 V-set	1.6e+02	13.9	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264832

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349252	0.999	Integrin alpha-L
2	9606.ENSP00000380948	0.999	Integrin beta-2
3	9606.ENSP00000441691	0.999	Integrin alpha-M
4	9606.ENSP00000356042	0.998	Ezrin
5	9606.ENSP00000484824	0.998	Mucin-1
6	9606.ENSP00000454623	0.995	Integrin alpha-X
7	9606.ENSP00000353238	0.987	Leukosialin
8	9606.ENSP00000264246	0.981	T-lymphocyte activation antigen CD80
9	9606.ENSP00000332049	0.980	T-lymphocyte activation antigen CD86
10	9606.ENSP00000370588	0.980	CD99 antigen
11	9606.ENSP00000412237	0.976	Interleukin-10
12	9606.ENSP00000264657	0.962	Signal transducer and activator of transcription 3
13	9606.ENSP00000327513	0.960	Macrophage colony-stimulating factor 1
14	9606.ENSP00000011653	0.959	T-cell surface glycoprotein CD4
15	9606.ENSP00000365435	0.958	Tumor necrosis factor receptor superfamily member 1B
16	9606.ENSP00000358490	0.953	T-cell surface antigen CD2
17	9606.ENSP00000305416	0.950	Sphingosine 1-phosphate receptor 1
18	9606.ENSP00000353408	0.949	Moesin
19	9606.ENSP00000386380	0.947	Interleukin-1 receptor type 1
20	9606.ENSP00000357470	0.946	Interleukin-6 receptor subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005178	1.000	integrin binding
GO:0060089	0.775	molecular transducer activity
GO:0038023	0.749	signaling receptor activity
GO:0004888	0.609	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0042981	0.993	regulation of apoptotic process
GO:0009987	0.992	cellular process
GO:0048522	0.990	positive regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0051716	0.964	cellular response to stimulus
GO:2000106	0.906	regulation of leukocyte apoptotic process
GO:0042221	0.902	response to chemical
GO:0002376	0.889	immune system process
GO:0048519	0.883	negative regulation of biological process
GO:0032502	0.871	developmental process
GO:0048856	0.862	anatomical structure development
GO:0010033	0.857	response to organic substance
GO:0032501	0.846	multicellular organismal process
GO:0007155	0.842	cell adhesion
GO:0048523	0.837	negative regulation of cellular process
GO:0048583	0.823	regulation of response to stimulus
GO:0043066	0.808	negative regulation of apoptotic process
GO:0043065	0.774	positive regulation of apoptotic process
GO:0070887	0.706	cellular response to chemical stimulus
GO:0006955	0.672	immune response
GO:0030334	0.583	regulation of cell migration
GO:0016477	0.578	cell migration
GO:0071310	0.574	cellular response to organic substance
GO:0010646	0.569	regulation of cell communication
GO:0023051	0.532	regulation of signaling
GO:0048869	0.526	cellular developmental process
GO:0002682	0.519	regulation of immune system process
GO:0019222	0.517	regulation of metabolic process
GO:0030154	0.516	cell differentiation
GO:0070228	0.506	regulation of lymphocyte apoptotic process
GO:0048584	0.497	positive regulation of response to stimulus
GO:0009966	0.492	regulation of signal transduction
GO:0060255	0.477	regulation of macromolecule metabolic process
GO:1901700	0.476	response to oxygen-containing compound
GO:0009893	0.463	positive regulation of metabolic process
GO:0051239	0.441	regulation of multicellular organismal process
GO:2000147	0.441	positive regulation of cell motility
GO:0002684	0.438	positive regulation of immune system process
GO:0098609	0.404	cell-cell adhesion
GO:0030335	0.379	positive regulation of cell migration
GO:1902533	0.369	positive regulation of intracellular signal transduction
GO:0007154	0.367	cell communication
GO:0010604	0.367	positive regulation of macromolecule metabolic process
GO:0044419	0.365	biological process involved in interspecies interaction between organisms
GO:0050900	0.360	leukocyte migration
GO:0023052	0.355	signaling
GO:0006950	0.350	response to stress
GO:0007165	0.348	signal transduction
GO:0009605	0.343	response to external stimulus
GO:0048585	0.334	negative regulation of response to stimulus
GO:1901701	0.301	cellular response to oxygen-containing compound
GO:0001775	0.300	cell activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005615	0.996	extracellular space
GO:0009986	0.988	cell surface
GO:0043226	0.973	organelle
GO:0043227	0.957	membrane-bounded organelle
GO:0005622	0.806	intracellular anatomical structure
GO:0043231	0.791	intracellular membrane-bounded organelle
GO:0031982	0.778	vesicle
GO:0005737	0.735	cytoplasm
GO:0070062	0.730	extracellular exosome
GO:0070161	0.571	anchoring junction
GO:0030312	0.521	external encapsulating structure
GO:0005925	0.495	focal adhesion
GO:0031012	0.474	extracellular matrix
GO:0062023	0.455	collagen-containing extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]