StarFunc result for job id P05386

User Input

>input (114 residues)
MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLI
CNVGAGGPAPAAGAAPAGGPAPSTAAAPAEEKKVEAKKEESEESDDDMGFGLFD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05386	1.000	1.000	7.882E-17	114	1.000	1.000	P05386.pdb.gz	RLA1_HUMAN Large ribosomal subunit protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1
2	PDB:4behA	0.455	0.455	9.437E-13	114	1.000	1.000	4behA.pdb.gz
3	AFDB:Q6P5K5	0.629	0.634	1.566E-11	113	0.816	0.823	Q6P5K5.pdb.gz	Q6P5K5_DANRE 60S acidic ribosomal protein P1 OS=Danio rerio OX=7955 GN=fa93f02 PE=1 SV=1
4	AFDB:P08570	0.567	0.577	9.528E-10	112	0.632	0.643	P08570.pdb.gz	RLA1_DROME Large ribosomal subunit protein P1 OS=Drosophila melanogaster OX=7227 GN=RpLP1 PE=1 SV=2
5	AFDB:P52855	0.596	0.622	8.706E-9	109	0.561	0.587	P52855.pdb.gz	RLA1_MAIZE Large ribosomal subunit protein P1 OS=Zea mays OX=4577 GN=RPP1A PE=1 SV=1
6	AFDB:O23095	0.573	0.578	1.745E-8	113	0.526	0.531	O23095.pdb.gz	RLA12_ARATH Large ribosomal subunit protein P1z OS=Arabidopsis thaliana OX=3702 GN=RPP1B PE=1 SV=2
7	AFDB:Q9FLV1	0.602	0.610	4.503E-8	111	0.412	0.423	Q9FLV1.pdb.gz	Q9FLV1_ARATH 60S acidic ribosomal protein family OS=Arabidopsis thaliana OX=3702 GN=At5g24510 PE=1 SV=1
8	AFDB:Q9UU78	0.576	0.601	3.863E-7	109	0.535	0.560	Q9UU78.pdb.gz	RLA5_SCHPO Large ribosomal subunit protein P1C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpp103 PE=1 SV=1
9	AFDB:P17477	0.583	0.602	4.383E-7	110	0.518	0.536	P17477.pdb.gz	RLA3_SCHPO Large ribosomal subunit protein P1B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpp102 PE=3 SV=1
10	AFDB:Q38BQ9	0.527	0.527	5.298E-7	114	0.447	0.447	Q38BQ9.pdb.gz	Q38BQ9_TRYB2 60S acidic ribosomal protein P2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4060 PE=3 SV=1
11	AFDB:P10622	0.568	0.608	8.247E-7	106	0.368	0.396	P10622.pdb.gz	RLA3_YEAST Large ribosomal subunit protein P1B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPP1B PE=1 SV=3
12	PDB:4v6iBt	0.458	0.863	4.342E-3	58	0.202	0.397	4v6iBt.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
13	PDB:4behB	0.393	0.387	9.874E-3	116	0.360	0.353	4behB.pdb.gz
14	PDB:1jr5A	0.280	0.340	2.739	90	0.079	0.100	1jr5A.pdb.gz
15	PDB:4uslA	0.213	0.159	2.918	173	0.044	0.029	4uslA.pdb.gz	Structural Basis of Sorcin-Mediated Calcium-Dependent Signal Transduction.
16	PDB:3fwbA	0.223	0.175	3.311	153	0.079	0.059	3fwbA.pdb.gz
17	PDB:2o03A	0.320	0.287	3.758	129	0.044	0.039	2o03A.pdb.gz	Crystal structure and function of the zinc uptake regulator FurB from Mycobacterium tuberculosis.
18	PDB:2ggmA	0.228	0.184	4.003	149	0.070	0.054	2ggmA.pdb.gz	The structure of the human centrin 2-xeroderma pigmentosum group C protein complex.
19	PDB:7egdF	0.211	0.068	4.264	412	0.132	0.036	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
20	PDB:6qfbC	0.142	0.032	5.154	1011	0.123	0.014	6qfbC.pdb.gz	Structure of ATP citrate lyase and the origin of citrate synthase in the Krebs cycle.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05386	4.09e-77	224	114	1.000	1.000	RLA1_HUMAN Large ribosomal subunit protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1
2	P19944	1.63e-75	220	114	0.982	0.982	RLA1_RAT Large ribosomal subunit protein P1 OS=Rattus norvegicus OX=10116 GN=Rplp1 PE=3 SV=1
3	P47955	1.27e-74	218	114	0.974	0.974	RLA1_MOUSE Large ribosomal subunit protein P1 OS=Mus musculus OX=10090 GN=Rplp1 PE=1 SV=1
4	Q6P5K5	7.68e-39	127	113	0.825	0.832	Q6P5K5_DANRE 60S acidic ribosomal protein P1 OS=Danio rerio OX=7955 GN=fa93f02 PE=1 SV=1
5	Q9FLV1	1.31e-29	104	111	0.509	0.523	Q9FLV1_ARATH 60S acidic ribosomal protein family OS=Arabidopsis thaliana OX=3702 GN=At5g24510 PE=1 SV=1
6	P08570	1.15e-27	99.8	112	0.544	0.554	RLA1_DROME Large ribosomal subunit protein P1 OS=Drosophila melanogaster OX=7227 GN=RpLP1 PE=1 SV=2
7	O23095	5.74e-23	87.8	113	0.509	0.513	RLA12_ARATH Large ribosomal subunit protein P1z OS=Arabidopsis thaliana OX=3702 GN=RPP1B PE=1 SV=2
8	Q8LCW9	3.05e-22	85.9	112	0.526	0.536	RLA11_ARATH Large ribosomal subunit protein P1w OS=Arabidopsis thaliana OX=3702 GN=RPP1A PE=3 SV=2
9	Q8LEQ0	9.73e-22	84.7	113	0.544	0.549	RLA13_ARATH Large ribosomal subunit protein P1y OS=Arabidopsis thaliana OX=3702 GN=RPP1C PE=1 SV=2
10	P52855	4.12e-18	75.1	109	0.491	0.514	RLA1_MAIZE Large ribosomal subunit protein P1 OS=Zea mays OX=4577 GN=RPP1A PE=1 SV=1
11	P17476	9.18e-17	71.6	109	0.430	0.450	RLA1_SCHPO Large ribosomal subunit protein P1A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpp101 PE=3 SV=1
12	P17477	9.21e-17	71.6	110	0.482	0.500	RLA3_SCHPO Large ribosomal subunit protein P1B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpp102 PE=3 SV=1
13	Q9UU78	3.46e-14	65.1	109	0.474	0.495	RLA5_SCHPO Large ribosomal subunit protein P1C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpp103 PE=1 SV=1
14	Q9HFQ7	8.17e-11	56.6	106	0.447	0.481	RLA1_CANAL Large ribosomal subunit protein P1A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPP1A PE=3 SV=1
15	P05318	1.30e-10	55.8	106	0.421	0.453	RLA1_YEAST Large ribosomal subunit protein P1A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPP1A PE=1 SV=4
16	Q9HFQ6	1.17e-09	53.5	108	0.430	0.454	RLA3_CANAX Large ribosomal subunit protein P1B OS=Candida albicans OX=5476 GN=RPP1B PE=1 SV=1
17	A0A1D8PRG5	2.00e-09	52.8	108	0.430	0.454	A0A1D8PRG5_CANAL Ribosomal protein P1B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPP1B PE=3 SV=1
18	P10622	2.08e-06	45.1	106	0.342	0.368	RLA3_YEAST Large ribosomal subunit protein P1B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPP1B PE=1 SV=3
19	Q38BQ9	1.54e-05	42.7	114	0.202	0.202	Q38BQ9_TRYB2 60S acidic ribosomal protein P2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4060 PE=3 SV=1
20	Q96UQ7	0.010	35.4	110	0.149	0.155	RLA2_RHOGU Large ribosomal subunit protein P2 OS=Rhodotorula glutinis OX=5535 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04625 DEC-1_N	4.3e+02	11.3	DEC-1 protein, N-terminal region
2	PF00428 Ribosomal_60s	5.1e-24	96.0	60s Acidic ribosomal protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006071088.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006045084.1	0.994	60S ribosomal protein L29
2	89462.XP_006049341.1	0.994	60S ribosomal protein L35
3	89462.XP_006053495.1	0.994	40S ribosomal protein S9
4	89462.XP_006070127.1	0.994	60S ribosomal protein L8
5	89462.XP_006039721.1	0.993	60S acidic ribosomal protein P0-like
6	89462.XP_006046787.1	0.993	40S ribosomal protein S28
7	89462.XP_006053033.1	0.993	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 23 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
8	89462.XP_006075303.1	0.993	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 15 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
9	89462.XP_006045943.1	0.992	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 20 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
10	89462.XP_006059412.1	0.992	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
11	89462.XP_006040203.1	0.991	60S ribosomal protein L19-like
12	89462.XP_006045870.1	0.991	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
13	89462.XP_006054218.1	0.991	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 17 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
14	89462.XP_006056556.1	0.991	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 ESTs, 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
15	89462.XP_006068605.1	0.991	60S ribosomal protein L19
16	89462.XP_006071069.1	0.991	Uncharacterized protein LOC102401365
17	89462.XP_006039638.1	0.990	60S ribosomal protein L28-like isoform X1
18	89462.XP_006039756.1	0.990	60S ribosomal protein L4-like
19	89462.XP_006039898.1	0.990	60S ribosomal protein L3-like
20	89462.XP_006040033.1	0.990	60S ribosomal protein L14-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003735	1.000	structural constituent of ribosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.987	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0006807	0.967	nitrogen compound metabolic process
GO:0043170	0.961	macromolecule metabolic process
GO:0010467	0.947	gene expression
GO:1901564	0.945	organonitrogen compound metabolic process
GO:0002181	0.935	cytoplasmic translation
GO:0065007	0.903	biological regulation
GO:0050789	0.872	regulation of biological process
GO:0050794	0.851	regulation of cellular process
GO:0019222	0.846	regulation of metabolic process
GO:0060255	0.830	regulation of macromolecule metabolic process
GO:0051171	0.824	regulation of nitrogen compound metabolic process
GO:0031323	0.811	regulation of cellular metabolic process
GO:0080090	0.799	regulation of primary metabolic process
GO:0010468	0.780	regulation of gene expression
GO:0034248	0.766	regulation of amide metabolic process
GO:0010608	0.724	post-transcriptional regulation of gene expression
GO:2000112	0.717	regulation of cellular macromolecule biosynthetic process
GO:0051246	0.646	regulation of protein metabolic process
GO:0006417	0.416	regulation of translation
GO:0048518	0.329	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0022626	1.000	cytosolic ribosome
GO:0015934	0.996	large ribosomal subunit
GO:0022625	0.994	cytosolic large ribosomal subunit
GO:0070013	0.921	intracellular organelle lumen
GO:0043231	0.831	intracellular membrane-bounded organelle
GO:0005634	0.800	nucleus
GO:0030054	0.798	cell junction
GO:0016020	0.357	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]