StarFunc result for job id P05387

User Input

>input (115 residues)
MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIG
KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02401	0.748	0.748	4.136E-15	115	0.974	0.974	P02401.pdb.gz	RLA2_RAT Large ribosomal subunit protein P2 OS=Rattus norvegicus OX=10116 GN=Rplp2 PE=1 SV=2
2	AFDB:A7E2K4	0.583	0.588	2.066E-11	114	0.748	0.754	A7E2K4.pdb.gz	A7E2K4_DANRE Large ribosomal subunit protein P2 OS=Danio rerio OX=7955 GN=rplp2l PE=1 SV=1
3	PDB:4behB	0.449	0.445	7.192E-11	116	1.000	0.991	4behB.pdb.gz
4	AFDB:P46252	0.565	0.577	4.886E-9	112	0.600	0.616	P46252.pdb.gz	RLA2A_MAIZE Large ribosomal subunit protein P2A OS=Zea mays OX=4577 GN=RPP2A PE=1 SV=3
5	AFDB:O24415	0.564	0.574	5.912E-9	113	0.557	0.566	O24415.pdb.gz	RLA2B_MAIZE Large ribosomal subunit protein P2B OS=Zea mays OX=4577 GN=RPP2B PE=1 SV=1
6	AFDB:P05389	0.600	0.610	5.912E-9	113	0.600	0.611	P05389.pdb.gz	RLA2_DROME Large ribosomal subunit protein P2 OS=Drosophila melanogaster OX=7227 GN=RpLP2 PE=1 SV=1
7	AFDB:Q9SLF7	0.593	0.593	7.623E-9	115	0.513	0.513	Q9SLF7.pdb.gz	RLA22_ARATH Large ribosomal subunit protein P2y OS=Arabidopsis thaliana OX=3702 GN=RPP2B PE=1 SV=1
8	AFDB:Q6FYB0	0.576	0.606	8.656E-9	109	0.565	0.596	Q6FYB0.pdb.gz	Q6FYB0_CANGA Candida glabrata strain CBS138 chromosome A complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0A03168g PE=3 SV=1
9	AFDB:Q9LXM8	0.585	0.605	2.246E-8	111	0.539	0.559	Q9LXM8.pdb.gz	RLA24_ARATH Large ribosomal subunit protein P2w OS=Arabidopsis thaliana OX=3702 GN=RPP2D PE=3 SV=1
10	AFDB:Q5ANH5	0.581	0.601	5.826E-8	111	0.548	0.568	Q5ANH5.pdb.gz	Q5ANH5_CANAL Ribosomal protein P2B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPP2B PE=3 SV=1
11	AFDB:Q96UQ7	0.564	0.588	5.826E-8	110	0.557	0.582	Q96UQ7.pdb.gz	RLA2_RHOGU Large ribosomal subunit protein P2 OS=Rhodotorula glutinis OX=5535 PE=1 SV=1
12	PDB:4behA	0.340	0.342	1.558E-2	114	0.357	0.360	4behA.pdb.gz
13	PDB:4v6iBt	0.361	0.652	8.540E-1	58	0.052	0.103	4v6iBt.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
14	PDB:1osaA	0.352	0.285	3.044	148	0.104	0.081	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
15	PDB:2ggmA	0.264	0.218	3.684	149	0.113	0.087	2ggmA.pdb.gz	The structure of the human centrin 2-xeroderma pigmentosum group C protein complex.
16	PDB:6hivDH	0.158	0.051	4.183	564	0.122	0.025	6hivDH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
17	PDB:2b8nA	0.189	0.060	5.062	414	0.061	0.017	2b8nA.pdb.gz
18	PDB:3qrxA	0.336	0.280	5.394	145	0.113	0.090	3qrxA.pdb.gz	The structure, molecular dynamics, and energetics of centrin-melittin complex.
19	PDB:1jfiB	0.178	0.157	5.748	135	0.087	0.074	1jfiB.pdb.gz	Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
20	PDB:5a2hA	0.375	0.304	5.748	147	0.087	0.068	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05387	2.32e-75	220	115	1.000	1.000	RLA2_HUMAN Large ribosomal subunit protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1
2	P99027	3.75e-75	219	115	0.991	0.991	RLA2_MOUSE Large ribosomal subunit protein P2 OS=Mus musculus OX=10090 GN=Rplp2 PE=1 SV=3
3	P02401	5.35e-74	216	115	0.974	0.974	RLA2_RAT Large ribosomal subunit protein P2 OS=Rattus norvegicus OX=10116 GN=Rplp2 PE=1 SV=2
4	A7E2K4	5.75e-32	110	114	0.678	0.684	A7E2K4_DANRE Large ribosomal subunit protein P2 OS=Danio rerio OX=7955 GN=rplp2l PE=1 SV=1
5	Q96UQ7	2.78e-26	96.3	110	0.522	0.545	RLA2_RHOGU Large ribosomal subunit protein P2 OS=Rhodotorula glutinis OX=5535 PE=1 SV=1
6	Q6FYB0	4.21e-24	90.5	109	0.513	0.541	Q6FYB0_CANGA Candida glabrata strain CBS138 chromosome A complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0A03168g PE=3 SV=1
7	P17478	2.13e-23	89.0	110	0.530	0.555	RLA4_SCHPO Large ribosomal subunit protein P2B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpp202 PE=1 SV=1
8	O24415	1.06e-21	84.7	113	0.522	0.531	RLA2B_MAIZE Large ribosomal subunit protein P2B OS=Zea mays OX=4577 GN=RPP2B PE=1 SV=1
9	Q5ANH5	1.51e-21	84.0	111	0.504	0.523	Q5ANH5_CANAL Ribosomal protein P2B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPP2B PE=3 SV=1
10	Q9HFQ4	1.51e-21	84.0	111	0.496	0.514	RLA4_CANAX Large ribosomal subunit protein P2B OS=Candida albicans OX=5476 GN=RPP2B PE=1 SV=1
11	P08094	7.68e-21	82.4	110	0.330	0.345	RLA2_SCHPO Large ribosomal subunit protein P2A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpp201 PE=1 SV=1
12	P46252	9.03e-21	82.0	112	0.522	0.536	RLA2A_MAIZE Large ribosomal subunit protein P2A OS=Zea mays OX=4577 GN=RPP2A PE=1 SV=3
13	O14317	3.93e-20	80.5	110	0.487	0.509	RLA6_SCHPO Large ribosomal subunit protein P2C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpp203 PE=1 SV=2
14	P02400	5.15e-20	80.1	110	0.478	0.500	RLA4_YEAST Large ribosomal subunit protein P2B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPP2B PE=1 SV=2
15	P05389	9.09e-20	79.7	113	0.339	0.345	RLA2_DROME Large ribosomal subunit protein P2 OS=Drosophila melanogaster OX=7227 GN=RpLP2 PE=1 SV=1
16	Q9LXM8	1.67e-18	76.3	111	0.513	0.532	RLA24_ARATH Large ribosomal subunit protein P2w OS=Arabidopsis thaliana OX=3702 GN=RPP2D PE=3 SV=1
17	Q9LH85	2.68e-16	70.9	115	0.383	0.383	RLA23_ARATH Large ribosomal subunit protein P2x OS=Arabidopsis thaliana OX=3702 GN=RPP2C PE=1 SV=1
18	A0A1D8PTS0	6.12e-15	67.0	108	0.470	0.500	A0A1D8PTS0_CANAL Ribosomal protein P2A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPP2A PE=3 SV=1
19	P22683	5.29e-14	64.7	106	0.470	0.509	RLA2_DICDI Large ribosomal subunit protein P2 OS=Dictyostelium discoideum OX=44689 GN=rplp2 PE=1 SV=3
20	Q9HFQ5	5.48e-13	62.0	108	0.452	0.481	RLA2_CANAX Large ribosomal subunit protein P2A OS=Candida albicans OX=5476 GN=RPP2A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17959 EF-hand_14	29	16.4	EF-hand domain
2	PF00428 Ribosomal_60s	2e-22	90.9	60s Acidic ribosomal protein
3	PF03540 TFIID_30kDa	5.7e+02	11.9	Transcription initiation factor TFIID 23-30kDa subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 109478.XP_005859290.1

Rank	PPI partner	STRING score	Description
1	109478.XP_005861853.1	0.997	60S ribosomal protein L38 isoform X1
2	109478.XP_005861964.1	0.997	60S ribosomal protein L19
3	109478.XP_005871303.1	0.997	60S ribosomal protein L31
4	109478.XP_005873195.1	0.997	Ribosomal protein L35a
5	109478.XP_005873938.1	0.997	60S ribosomal protein L18a
6	109478.XP_005881578.1	0.997	60S ribosomal protein L35
7	109478.XP_005883945.1	0.997	40S ribosomal protein S19
8	109478.XP_005865115.1	0.996	60S ribosomal protein L8
9	109478.XP_005866434.1	0.996	60S ribosomal protein L7
10	109478.XP_005866755.1	0.996	Belongs to the universal ribosomal protein uS19 family.
11	109478.XP_005871449.1	0.996	60S ribosomal protein L3
12	109478.XP_005875279.1	0.996	60S ribosomal protein L11
13	109478.XP_005879039.1	0.996	60S ribosomal protein L5
14	109478.XP_005881838.1	0.996	60S ribosomal protein L10a
15	109478.XP_005885643.1	0.996	40S ribosomal protein S21 isoform X1
16	109478.XP_005862136.1	0.995	60S ribosomal protein L4
17	109478.XP_005863712.1	0.995	Belongs to the eukaryotic ribosomal protein eL15 family.
18	109478.XP_005868371.1	0.995	60S ribosomal protein L39-like
19	109478.XP_005870768.1	0.995	Ribosomal protein S28
20	109478.XP_005880022.1	0.995	40S ribosomal protein S9 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003735	1.000	structural constituent of ribosome
GO:0005515	0.997	protein binding
GO:0003676	0.414	nucleic acid binding
GO:0044877	0.388	protein-containing complex binding
GO:0003723	0.342	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0080090	0.964	regulation of primary metabolic process
GO:0051171	0.964	regulation of nitrogen compound metabolic process
GO:0060255	0.962	regulation of macromolecule metabolic process
GO:0048518	0.956	positive regulation of biological process
GO:0009893	0.938	positive regulation of metabolic process
GO:0031323	0.934	regulation of cellular metabolic process
GO:0051246	0.906	regulation of protein metabolic process
GO:0048522	0.899	positive regulation of cellular process
GO:0008152	0.829	metabolic process
GO:0010604	0.805	positive regulation of macromolecule metabolic process
GO:0044237	0.803	cellular metabolic process
GO:0071704	0.796	organic substance metabolic process
GO:0051173	0.788	positive regulation of nitrogen compound metabolic process
GO:0044238	0.778	primary metabolic process
GO:0010468	0.772	regulation of gene expression
GO:0010556	0.765	regulation of macromolecule biosynthetic process
GO:0050896	0.751	response to stimulus
GO:0006807	0.743	nitrogen compound metabolic process
GO:0031325	0.738	positive regulation of cellular metabolic process
GO:0043170	0.725	macromolecule metabolic process
GO:0031326	0.714	regulation of cellular biosynthetic process
GO:0034248	0.671	regulation of amide metabolic process
GO:2000112	0.671	regulation of cellular macromolecule biosynthetic process
GO:0051716	0.649	cellular response to stimulus
GO:0034641	0.645	cellular nitrogen compound metabolic process
GO:0051247	0.629	positive regulation of protein metabolic process
GO:0010608	0.612	post-transcriptional regulation of gene expression
GO:0006417	0.576	regulation of translation
GO:0034250	0.537	positive regulation of amide metabolic process
GO:0046683	0.514	response to organophosphorus
GO:1901564	0.496	organonitrogen compound metabolic process
GO:0014074	0.460	response to purine-containing compound
GO:0010628	0.443	positive regulation of gene expression
GO:0010467	0.411	gene expression
GO:0070887	0.410	cellular response to chemical stimulus
GO:0044260	0.405	cellular macromolecule metabolic process
GO:0044249	0.383	cellular biosynthetic process
GO:0071417	0.375	cellular response to organonitrogen compound
GO:1901700	0.369	response to oxygen-containing compound
GO:1901576	0.351	organic substance biosynthetic process
GO:0009059	0.339	macromolecule biosynthetic process
GO:0045727	0.336	positive regulation of translation
GO:0019538	0.335	protein metabolic process
GO:0044271	0.332	cellular nitrogen compound biosynthetic process
GO:0051591	0.323	response to cAMP
GO:0006412	0.302	translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0022626	0.999	cytosolic ribosome
GO:0044391	0.998	ribosomal subunit
GO:0022625	0.990	cytosolic large ribosomal subunit
GO:0043227	0.940	membrane-bounded organelle
GO:0070013	0.913	intracellular organelle lumen
GO:0016020	0.845	membrane
GO:0030054	0.843	cell junction
GO:0043231	0.829	intracellular membrane-bounded organelle
GO:0065010	0.694	extracellular membrane-bounded organelle
GO:0070062	0.678	extracellular exosome
GO:0005634	0.606	nucleus
GO:0031981	0.453	nuclear lumen
GO:0012505	0.425	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]