StarFunc result for job id P05412

User Input

>input (331 residues)
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05627	0.583	0.578	2.875E-46	334	0.973	0.964	P05627.pdb.gz	JUN_MOUSE Transcription factor Jun OS=Mus musculus OX=10090 GN=Jun PE=1 SV=3
2	AFDB:P18870	0.335	0.352	1.022E-36	314	0.831	0.876	P18870.pdb.gz	JUN_CHICK Transcription factor Jun OS=Gallus gallus OX=9031 GN=JUN PE=1 SV=2
3	AFDB:Q4ZJE9	0.295	0.318	2.996E-30	308	0.743	0.799	Q4ZJE9.pdb.gz
4	AFDB:A8E7N0	0.443	0.450	4.169E-22	325	0.502	0.511	A8E7N0.pdb.gz
5	AFDB:A0A0R4IAV4	0.301	0.316	6.134E-21	310	0.514	0.548	A0A0R4IAV4.pdb.gz
6	AFDB:P15066	0.303	0.295	1.239E-18	341	0.544	0.528	P15066.pdb.gz	JUND_MOUSE Transcription factor JunD OS=Mus musculus OX=10090 GN=Jund PE=1 SV=1
7	AFDB:A7RIQ6	0.284	0.276	2.368E-14	343	0.366	0.353	A7RIQ6.pdb.gz	A7RIQ6_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g238589 PE=1 SV=1
8	AFDB:Q4H3A1	0.280	0.246	3.631E-12	381	0.384	0.333	Q4H3A1.pdb.gz	Q4H3A1_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-Jun PE=1 SV=1
9	AFDB:A1YB07	0.208	0.103	6.216E-4	721	0.154	0.071	A1YB07.pdb.gz	AMOL2_DANRE Angiomotin-like 2a OS=Danio rerio OX=7955 GN=amotl2a PE=1 SV=2
10	AFDB:F4I9R1	0.193	0.173	6.216E-4	374	0.169	0.150	F4I9R1.pdb.gz	F4I9R1_ARATH Basic-leucine zipper (BZIP) transcription factor family protein OS=Arabidopsis thaliana OX=3702 GN=At1g58110 PE=1 SV=1
11	PDB:6n7pA	0.081	0.128	9.605E-1	186	0.057	0.102	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
12	PDB:7ajtJM	0.068	0.157	5.383	135	0.048	0.119	7ajtJM.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	PDB:5dgesM	0.059	0.129	5.767	104	0.057	0.183	5dgesM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
14	PDB:6zqaUB	0.208	0.139	5.767	504	0.060	0.040	6zqaUB.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
15	PDB:3jcmG	0.056	0.031	6.178	734	0.048	0.022	3jcmG.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
16	PDB:5mrcQ	0.077	0.090	7.091	284	0.060	0.070	5mrcQ.pdb.gz	The structure of the yeast mitochondrial ribosome.
17	PDB:6rlbC	0.078	0.055	7.091	494	0.045	0.030	6rlbC.pdb.gz
18	PDB:7ajtCK	0.069	0.098	7.598	207	0.082	0.130	7ajtCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
19	PDB:7mqaSI	0.065	0.032	8.140	803	0.076	0.031	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:5mpsK	0.085	0.116	8.721	187	0.033	0.059	5mpsK.pdb.gz	Structure of a spliceosome remodelled for exon ligation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05412	0.0	675	331	1.000	1.000	JUN_HUMAN Transcription factor Jun OS=Homo sapiens OX=9606 GN=JUN PE=1 SV=2
2	P05627	0.0	652	334	0.973	0.964	JUN_MOUSE Transcription factor Jun OS=Mus musculus OX=10090 GN=Jun PE=1 SV=3
3	P17325	0.0	649	334	0.967	0.958	JUN_RAT Transcription factor Jun OS=Rattus norvegicus OX=10116 GN=Jun PE=1 SV=1
4	P18870	0.0	538	314	0.837	0.882	JUN_CHICK Transcription factor Jun OS=Gallus gallus OX=9031 GN=JUN PE=1 SV=2
5	P56432	0.0	642	331	0.958	0.958	JUN_PIG Transcription factor Jun OS=Sus scrofa OX=9823 GN=JUN PE=2 SV=1
6	Q6NZT5	1.04e-169	475	308	0.743	0.799	Q6NZT5_DANRE Jun proto-oncogene, AP-1 transcription factor subunit OS=Danio rerio OX=7955 GN=c-Jun PE=2 SV=1
7	Q2L4Q5	4.83e-153	434	327	0.698	0.706	Q2L4Q5_ONCMY Transcription factor AP-1 OS=Oncorhynchus mykiss OX=8022 GN=jun PE=2 SV=1
8	Q7T3E3	1.20e-93	282	310	0.520	0.555	Q7T3E3_DANRE Jun B proto-oncogene, like OS=Danio rerio OX=7955 GN=junbl PE=2 SV=1
9	Q7T367	1.38e-88	270	325	0.511	0.520	Q7T367_DANRE Jun B proto-oncogene OS=Danio rerio OX=7955 GN=junb PE=2 SV=1
10	P15066	5.50e-85	261	341	0.520	0.504	JUND_MOUSE Transcription factor JunD OS=Mus musculus OX=10090 GN=Jund PE=1 SV=1
11	P52909	5.50e-85	261	341	0.520	0.504	JUND_RAT Transcription factor JunD OS=Rattus norvegicus OX=10116 GN=Jund PE=1 SV=1
12	P17535	1.64e-80	250	347	0.480	0.458	JUND_HUMAN Transcription factor JunD OS=Homo sapiens OX=9606 GN=JUND PE=1 SV=3
13	P09450	3.42e-77	241	344	0.514	0.494	JUNB_MOUSE Transcription factor JunB OS=Mus musculus OX=10090 GN=Junb PE=1 SV=1
14	P24898	3.42e-77	241	344	0.514	0.494	JUNB_RAT Transcription factor JunB OS=Rattus norvegicus OX=10116 GN=Junb PE=1 SV=2
15	P17275	4.47e-69	221	347	0.498	0.476	JUNB_HUMAN Transcription factor JunB OS=Homo sapiens OX=9606 GN=JUNB PE=1 SV=1
16	Q5U079	4.47e-69	221	347	0.498	0.476	Q5U079_HUMAN Jun B proto-oncogene OS=Homo sapiens OX=9606 GN=JUNB PE=2 SV=1
17	Q4H3A1	2.43e-60	199	381	0.372	0.323	Q4H3A1_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-Jun PE=1 SV=1
18	A7RIQ6	1.61e-46	162	343	0.399	0.385	A7RIQ6_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g238589 PE=1 SV=1
19	A7RWP1	3.98e-31	116	135	0.169	0.415	A7RWP1_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g95962 PE=1 SV=1
20	P18289	1.68e-30	119	289	0.166	0.190	JRA_DROME Transcription factor Jra OS=Drosophila melanogaster OX=7227 GN=Jra PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	3.5e-14	64.0	bZIP transcription factor
2	PF07716 bZIP_2	1.7e-05	36.1	Basic region leucine zipper
3	PF03131 bZIP_Maf	4.7e-05	35.2	bZIP Maf transcription factor
4	PF11932 DUF3450	7.6e+02	10.8	Protein of unknown function (DUF3450)
5	PF08702 Fib_alpha	29	16.3	Fibrinogen alpha/beta chain family
6	PF05377 FlaC_arch	80	15.0	Flagella accessory protein C (FlaC)
7	PF03957 Jun	2.5e-86	300.9	Jun-like transcription factor
8	PF08537 NBP1	1.1e+02	13.6	Fungal Nap binding protein NBP1
9	PF04012 PspA_IM30	25	15.9	PspA/IM30 family
10	PF03153 TFIIA	96	14.4	Transcription factor IIA, alpha/beta subunit
11	PF06005 ZapB	7.7	18.4	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360266

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000243440	0.999	Basic leucine zipper transcriptional factor ATF-like 3
2	9606.ENSP00000245919	0.999	Protein fosB
3	9606.ENSP00000263253	0.999	Histone acetyltransferase p300
4	9606.ENSP00000264110	0.999	Cyclic AMP-dependent transcription factor ATF-2
5	9606.ENSP00000264716	0.999	Fos-related antigen 2
6	9606.ENSP00000306245	0.999	Proto-oncogene c-Fos
7	9606.ENSP00000310170	0.999	Fos-related antigen 1
8	9606.ENSP00000332973	0.999	Mothers against decapentaplegic homolog 3
9	9606.ENSP00000344352	0.999	Cyclic AMP-dependent transcription factor ATF-3
10	9606.ENSP00000344456	0.999	Catenin beta-1
11	9606.ENSP00000352157	0.999	Mitogen-activated protein kinase 10
12	9606.ENSP00000378974	0.999	Mitogen-activated protein kinase 8
13	9606.ENSP00000379330	0.999	Nuclear factor of activated T-cells, cytoplasmic 2
14	9606.ENSP00000380252	0.999	Nuclear factor erythroid 2-related factor 2
15	9606.ENSP00000394560	0.999	Mitogen-activated protein kinase 9
16	9606.ENSP00000405330	0.999	Estrogen receptor
17	9606.ENSP00000471896	0.999	Interferon regulatory factor 3
18	9606.ENSP00000231509	0.998	Glucocorticoid receptor
19	9606.ENSP00000262367	0.998	CREB-binding protein
20	9606.ENSP00000329357	0.998	Transcription factor Sp1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	0.998	sequence-specific DNA binding
GO:0003690	0.995	double-stranded DNA binding
GO:1990837	0.978	sequence-specific double-stranded DNA binding
GO:0140110	0.963	transcription regulator activity
GO:0000976	0.949	transcription cis-regulatory region binding
GO:0003700	0.843	DNA-binding transcription factor activity
GO:0000981	0.713	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0042802	0.660	identical protein binding
GO:0003682	0.385	chromatin binding
GO:0008134	0.305	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0048518	0.997	positive regulation of biological process
GO:0080090	0.996	regulation of primary metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0010468	0.996	regulation of gene expression
GO:0009889	0.993	regulation of biosynthetic process
GO:0048522	0.990	positive regulation of cellular process
GO:0009987	0.989	cellular process
GO:0051252	0.989	regulation of RNA metabolic process
GO:0010604	0.981	positive regulation of macromolecule metabolic process
GO:0031326	0.976	regulation of cellular biosynthetic process
GO:0010556	0.975	regulation of macromolecule biosynthetic process
GO:0051173	0.967	positive regulation of nitrogen compound metabolic process
GO:2001141	0.965	regulation of RNA biosynthetic process
GO:0051716	0.964	cellular response to stimulus
GO:0006355	0.964	regulation of DNA-templated transcription
GO:0031325	0.960	positive regulation of cellular metabolic process
GO:0042221	0.935	response to chemical
GO:0007154	0.926	cell communication
GO:0023052	0.923	signaling
GO:0045893	0.908	positive regulation of DNA-templated transcription
GO:0006357	0.897	regulation of transcription by RNA polymerase II
GO:0032501	0.890	multicellular organismal process
GO:0045944	0.873	positive regulation of transcription by RNA polymerase II
GO:0070887	0.860	cellular response to chemical stimulus
GO:0010033	0.840	response to organic substance
GO:0048856	0.839	anatomical structure development
GO:0044419	0.812	biological process involved in interspecies interaction between organisms
GO:1901701	0.812	cellular response to oxygen-containing compound
GO:0008152	0.760	metabolic process
GO:0006950	0.737	response to stress
GO:0007165	0.724	signal transduction
GO:0048519	0.717	negative regulation of biological process
GO:0048523	0.706	negative regulation of cellular process
GO:0065009	0.667	regulation of molecular function
GO:0042127	0.662	regulation of cell population proliferation
GO:0010038	0.612	response to metal ion
GO:0071704	0.608	organic substance metabolic process
GO:0044237	0.584	cellular metabolic process
GO:0007275	0.571	multicellular organism development
GO:0044238	0.568	primary metabolic process
GO:0006807	0.540	nitrogen compound metabolic process
GO:0010941	0.540	regulation of cell death
GO:0009719	0.536	response to endogenous stimulus
GO:0071310	0.497	cellular response to organic substance
GO:0048583	0.479	regulation of response to stimulus
GO:0043170	0.477	macromolecule metabolic process
GO:0009892	0.447	negative regulation of metabolic process
GO:0010605	0.438	negative regulation of macromolecule metabolic process
GO:0023051	0.432	regulation of signaling
GO:0010646	0.431	regulation of cell communication
GO:0048731	0.431	system development
GO:0050793	0.421	regulation of developmental process
GO:0071840	0.420	cellular component organization or biogenesis
GO:0051239	0.419	regulation of multicellular organismal process
GO:0009966	0.410	regulation of signal transduction
GO:0048584	0.378	positive regulation of response to stimulus
GO:0016043	0.373	cellular component organization
GO:0033554	0.366	cellular response to stress
GO:0051172	0.364	negative regulation of nitrogen compound metabolic process
GO:0042981	0.363	regulation of apoptotic process
GO:0031324	0.362	negative regulation of cellular metabolic process
GO:0007166	0.361	cell surface receptor signaling pathway
GO:0009605	0.354	response to external stimulus
GO:0051246	0.350	regulation of protein metabolic process
GO:0071495	0.349	cellular response to endogenous stimulus
GO:0002376	0.342	immune system process
GO:1902893	0.315	regulation of miRNA transcription
GO:0031399	0.311	regulation of protein modification process
GO:2000630	0.307	positive regulation of miRNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.992	protein-containing complex
GO:0031981	0.989	nuclear lumen
GO:0005654	0.979	nucleoplasm
GO:0043228	0.955	non-membrane-bounded organelle
GO:0043232	0.946	intracellular non-membrane-bounded organelle
GO:0005737	0.923	cytoplasm
GO:0005829	0.838	cytosol
GO:0005667	0.718	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]