StarFunc result for job id P05413

User Input

>input (133 residues)
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05413	1.000	1.000	1.043E-23	133	1.000	1.000	P05413.pdb.gz	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
2	PDB:5hz9A	0.986	0.971	6.988E-22	135	0.992	0.978	5hz9A.pdb.gz	Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.
3	AFDB:P07483	0.998	0.998	1.517E-21	133	0.895	0.895	P07483.pdb.gz	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
4	PDB:7yf1A	0.978	0.978	4.430E-20	133	0.842	0.842	7yf1A.pdb.gz
5	AFDB:Q8UVG7	0.989	0.989	5.906E-19	133	0.729	0.729	Q8UVG7.pdb.gz	Q8UVG7_DANRE Fatty acid-binding protein 3, muscle and heart OS=Danio rerio OX=7955 GN=H-FABP PE=1 SV=1
6	AFDB:F1MHQ4	0.985	0.993	7.268E-19	132	0.632	0.636	F1MHQ4.pdb.gz	F1MHQ4_BOVIN Fatty acid binding protein 4, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=3 SV=2
7	AFDB:P02689	0.985	0.992	1.502E-18	132	0.624	0.629	P02689.pdb.gz	MYP2_HUMAN Myelin P2 protein OS=Homo sapiens OX=9606 GN=PMP2 PE=1 SV=3
8	AFDB:P04117	0.979	0.987	1.502E-18	132	0.639	0.644	P04117.pdb.gz	FABP4_MOUSE Fatty acid-binding protein, adipocyte OS=Mus musculus OX=10090 GN=Fabp4 PE=1 SV=3
9	AFDB:O97788	0.981	0.989	1.755E-18	132	0.624	0.629	O97788.pdb.gz	FABP4_PIG Fatty acid-binding protein, adipocyte OS=Sus scrofa OX=9823 GN=FABP4 PE=1 SV=3
10	AFDB:O15540	0.986	0.994	2.275E-18	132	0.662	0.667	O15540.pdb.gz	FABP7_HUMAN Fatty acid-binding protein, brain OS=Homo sapiens OX=9606 GN=FABP7 PE=1 SV=3
11	AFDB:A0A0K0MJN3	0.986	0.994	4.465E-18	132	0.571	0.576	A0A0K0MJN3.pdb.gz	FABP4_PYGPA Fatty acid-binding protein, adipocyte OS=Pygoscelis papua OX=30457 GN=FABP4 PE=1 SV=1
12	AFDB:Q0Z7S8	0.990	0.997	4.465E-18	132	0.549	0.553	Q0Z7S8.pdb.gz	FABP9_HUMAN Fatty acid-binding protein 9 OS=Homo sapiens OX=9606 GN=FABP9 PE=1 SV=1
13	PDB:7e25A	0.971	0.930	6.440E-18	139	0.654	0.626	7e25A.pdb.gz	Crystal structure of human brain-type fatty acid-binding protein FABP7 complexed with palmitic acid.
14	PDB:3nr3A	0.987	0.972	9.751E-18	135	0.617	0.607	3nr3A.pdb.gz
15	PDB:2qm9A	0.967	0.926	1.139E-17	139	0.632	0.604	2qm9A.pdb.gz	Structural Basis for Activation of Fatty Acid-binding Protein 4
16	PDB:3p6dA	0.967	0.926	3.215E-17	139	0.632	0.604	3p6dA.pdb.gz	Structural analysis of ibuprofen binding to human adipocyte fatty-acid binding protein (FABP4).
17	PDB:4a60A	0.967	0.912	1.524E-16	141	0.541	0.511	4a60A.pdb.gz
18	PDB:4azqA	0.979	0.958	9.361E-16	136	0.466	0.456	4azqA.pdb.gz	Crystallographic Study of Fabp5 as an Intracellular Endocannabinoid Transporter.
19	PDB:5bvsA	0.949	0.955	1.837E-15	132	0.571	0.576	5bvsA.pdb.gz	Structural basis for the ligand-binding specificity of fatty acid-binding proteins (pFABP4 and pFABP5) in gentoo penguin
20	PDB:5ggeA	0.896	0.923	3.423E-15	129	0.526	0.543	5ggeA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05413	5.43e-94	268	133	1.000	1.000	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
2	P07483	4.12e-85	246	133	0.895	0.895	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
3	P11404	2.19e-83	242	133	0.857	0.857	FABPH_MOUSE Fatty acid-binding protein, heart OS=Mus musculus OX=10090 GN=Fabp3 PE=1 SV=5
4	Q8UVG7	1.65e-66	199	133	0.729	0.729	Q8UVG7_DANRE Fatty acid-binding protein 3, muscle and heart OS=Danio rerio OX=7955 GN=H-FABP PE=1 SV=1
5	O15540	7.17e-63	190	132	0.662	0.667	FABP7_HUMAN Fatty acid-binding protein, brain OS=Homo sapiens OX=9606 GN=FABP7 PE=1 SV=3
6	Q05423	1.45e-62	189	132	0.662	0.667	FABP7_CHICK Fatty acid-binding protein, brain OS=Gallus gallus OX=9031 GN=FABP7 PE=2 SV=2
7	P55051	2.44e-60	183	132	0.624	0.629	FABP7_RAT Fatty acid-binding protein, brain OS=Rattus norvegicus OX=10116 GN=Fabp7 PE=1 SV=2
8	P51880	4.71e-59	180	132	0.617	0.621	FABP7_MOUSE Fatty acid-binding protein, brain OS=Mus musculus OX=10090 GN=Fabp7 PE=1 SV=2
9	P04117	7.62e-59	180	132	0.639	0.644	FABP4_MOUSE Fatty acid-binding protein, adipocyte OS=Mus musculus OX=10090 GN=Fabp4 PE=1 SV=3
10	P02689	9.29e-59	179	132	0.624	0.629	MYP2_HUMAN Myelin P2 protein OS=Homo sapiens OX=9606 GN=PMP2 PE=1 SV=3
11	O97788	1.11e-58	179	132	0.624	0.629	FABP4_PIG Fatty acid-binding protein, adipocyte OS=Sus scrofa OX=9823 GN=FABP4 PE=1 SV=3
12	P15090	2.23e-58	179	132	0.639	0.644	FABP4_HUMAN Fatty acid-binding protein, adipocyte OS=Homo sapiens OX=9606 GN=FABP4 PE=1 SV=3
13	F1MHQ4	2.46e-58	178	132	0.632	0.636	F1MHQ4_BOVIN Fatty acid binding protein 4, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=3 SV=2
14	P48035	4.26e-58	178	132	0.632	0.636	FABP4_BOVIN Fatty acid-binding protein, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=2 SV=2
15	P24526	2.32e-56	173	132	0.602	0.606	MYP2_MOUSE Myelin P2 protein OS=Mus musculus OX=10090 GN=Pmp2 PE=2 SV=2
16	P70623	2.96e-56	173	132	0.617	0.621	FABP4_RAT Fatty acid-binding protein, adipocyte OS=Rattus norvegicus OX=10116 GN=Fabp4 PE=1 SV=3
17	A0A0K0MJN3	4.23e-55	170	132	0.571	0.576	FABP4_PYGPA Fatty acid-binding protein, adipocyte OS=Pygoscelis papua OX=30457 GN=FABP4 PE=1 SV=1
18	Q0Z7S8	2.93e-52	163	132	0.549	0.553	FABP9_HUMAN Fatty acid-binding protein 9 OS=Homo sapiens OX=9606 GN=FABP9 PE=1 SV=1
19	P55054	6.77e-48	152	132	0.481	0.485	FABP9_RAT Fatty acid-binding protein 9 OS=Rattus norvegicus OX=10116 GN=Fabp9 PE=1 SV=1
20	Q66I80	1.19e-47	151	134	0.556	0.552	Q66I80_DANRE Fatty acid binding protein 11a OS=Danio rerio OX=7955 GN=fabp11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00061 Lipocalin	4.6e-26	103.2	Lipocalin / cytosolic fatty-acid binding protein family
2	PF14651 Lipocalin_7	1.2e-05	36.7	Lipocalin / cytosolic fatty-acid binding protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362817

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245206	0.888	Aspartate aminotransferase, mitochondrial
2	9606.ENSP00000295834	0.841	Fatty acid-binding protein, liver
3	9606.ENSP00000354859	0.828	D(2) dopamine receptor
4	9606.ENSP00000377549	0.808	Gastrotropin
5	9606.ENSP00000244289	0.805	Hormone-sensitive lipase
6	9606.ENSP00000243167	0.767	Fatty-acid amide hydrolase 1
7	9606.ENSP00000383003	0.741	Peptidyl-prolyl cis-trans isomerase FKBP1A
8	9606.ENSP00000432282	0.738	Transgelin
9	9606.ENSP00000341838	0.716	Troponin I, cardiac muscle
10	9606.ENSP00000380489	0.702	Myoglobin
11	9606.ENSP00000304229	0.685	Histidine triad nucleotide-binding protein 1
12	9606.ENSP00000262462	0.670	Long-chain fatty acid transport protein 6
13	9606.ENSP00000252595	0.669	Long-chain fatty acid transport protein 1
14	9606.ENSP00000256104	0.667	Fatty acid-binding protein, adipocyte
15	9606.ENSP00000379011	0.654	Carnitine O-palmitoyltransferase 1, muscle isoform
16	9606.ENSP00000385523	0.643	Peroxisome proliferator-activated receptor alpha
17	9606.ENSP00000236918	0.628	Troponin T, cardiac muscle
18	9606.ENSP00000376303	0.616	Carnitine O-palmitoyltransferase 1, brain isoform
19	9606.ENSP00000422607	0.612	Long-chain-fatty-acid--CoA ligase 1
20	9606.ENSP00000304592	0.598	Fatty acid synthase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0036041	0.995	long-chain fatty acid binding
GO:0008092	0.386	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.945	biological regulation
GO:0009987	0.935	cellular process
GO:0050789	0.935	regulation of biological process
GO:0050794	0.848	regulation of cellular process
GO:0071704	0.841	organic substance metabolic process
GO:0046942	0.795	carboxylic acid transport
GO:0019216	0.781	regulation of lipid metabolic process
GO:0044238	0.770	primary metabolic process
GO:0009893	0.761	positive regulation of metabolic process
GO:0044237	0.755	cellular metabolic process
GO:0006869	0.748	lipid transport
GO:0015908	0.734	fatty acid transport
GO:0046890	0.724	regulation of lipid biosynthetic process
GO:0015909	0.708	long-chain fatty acid transport
GO:0048522	0.698	positive regulation of cellular process
GO:0031323	0.690	regulation of cellular metabolic process
GO:0045834	0.672	positive regulation of lipid metabolic process
GO:1903725	0.631	regulation of phospholipid metabolic process
GO:0050896	0.520	response to stimulus
GO:0042127	0.445	regulation of cell population proliferation
GO:0044281	0.442	small molecule metabolic process
GO:0006629	0.436	lipid metabolic process
GO:0071071	0.410	regulation of phospholipid biosynthetic process
GO:0031325	0.408	positive regulation of cellular metabolic process
GO:0044255	0.393	cellular lipid metabolic process
GO:0048519	0.374	negative regulation of biological process
GO:0019752	0.351	carboxylic acid metabolic process
GO:0032787	0.319	monocarboxylic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0043227	0.967	membrane-bounded organelle
GO:0005576	0.936	extracellular region
GO:0043231	0.884	intracellular membrane-bounded organelle
GO:0031982	0.844	vesicle
GO:0005615	0.765	extracellular space
GO:0070062	0.763	extracellular exosome
GO:0016020	0.364	membrane
GO:0005634	0.335	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]