StarFunc result for job id P05423

User Input

>input (398 residues)
MSEGNAAGEPSTPGGPRPLLTGARGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTP
NIISRKIKEEPKEEVTVKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKK
GNWDKTVDVSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFLDDPGLRNDTRNMPVQL
PLAHSGWLFKEENDEPDVKPWLAGPKEEDMEVDIPAVKVKEEPRDEEEEAKMKAPPKAAR
KTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVL
IKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQEL
VSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05423	1.000	1.000	1.599E-64	398	1.000	1.000	P05423.pdb.gz	RPC4_HUMAN DNA-directed RNA polymerase III subunit RPC4 OS=Homo sapiens OX=9606 GN=POLR3D PE=1 SV=2
2	PDB:7a6hN	0.296	0.607	1.480E-20	186	0.467	1.000	7a6hN.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
3	PDB:7d58N	0.282	0.776	3.085E-17	136	0.304	0.890	7d58N.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
4	PDB:7dn3N	0.206	0.769	5.092E-10	92	0.214	0.924	7dn3N.pdb.gz	Structure of human RNA polymerase III elongation complex.
5	PDB:7z1lN	0.228	0.560	5.435E-8	153	0.083	0.216	7z1lN.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
6	AFDB:Q94546	0.174	0.103	2.969E-5	725	0.153	0.084	Q94546.pdb.gz	ATU_DROME Another transcription unit protein OS=Drosophila melanogaster OX=7227 GN=Atu PE=1 SV=2
7	AFDB:Q5XJE5	0.178	0.114	3.793E-4	667	0.156	0.093	Q5XJE5.pdb.gz	LEO1_MOUSE RNA polymerase-associated protein LEO1 OS=Mus musculus OX=10090 GN=Leo1 PE=1 SV=2
8	PDB:5svag	0.143	0.305	1.362E-3	172	0.033	0.076	5svag.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
9	PDB:5fj9N	0.168	0.507	1.448E-3	105	0.063	0.238	5fj9N.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
10	PDB:5fywR	0.140	0.263	1.538E-3	199	0.033	0.065	5fywR.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening
11	PDB:7o4iR	0.184	0.259	1.736E-3	268	0.050	0.075	7o4iR.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
12	PDB:7edxT	0.148	0.454	5.174E-3	113	0.038	0.133	7edxT.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	PDB:6tedU	0.165	0.420	7.007E-3	125	0.053	0.168	6tedU.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
14	AFDB:Q17865	0.081	0.063	1.206E-1	545	0.153	0.112	Q17865.pdb.gz	YTE4_CAEEL Uncharacterized protein C09G1.4 OS=Caenorhabditis elegans OX=6239 GN=C09G1.4 PE=1 SV=3
15	AFDB:W5U9R6	0.098	0.055	1.282E-1	879	0.126	0.057	W5U9R6.pdb.gz	W5U9R6_ICTPU Nuclear factor of activated T-cells, cytoplasmic 1 OS=Ictalurus punctatus OX=7998 GN=NFATC1 PE=2 SV=1
16	AFDB:Q9ZNQ8	0.073	0.052	1.362E-1	633	0.146	0.092	Q9ZNQ8.pdb.gz	PERK4_ARATH Proline-rich receptor-like protein kinase PERK4 OS=Arabidopsis thaliana OX=3702 GN=PERK4 PE=1 SV=1
17	AFDB:Q9VRY7	0.072	0.051	2.351E-1	659	0.141	0.085	Q9VRY7.pdb.gz	Q9VRY7_DROME GH13213p OS=Drosophila melanogaster OX=7227 GN=Rsph3 PE=1 SV=1
18	AFDB:Q8I5K3	0.084	0.023	2.654E-1	2329	0.128	0.022	Q8I5K3.pdb.gz	Q8I5K3_PLAF7 Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1221000 PE=4 SV=1
19	AFDB:Q9LV48	0.076	0.053	2.654E-1	652	0.166	0.101	Q9LV48.pdb.gz	PERK1_ARATH Proline-rich receptor-like protein kinase PERK1 OS=Arabidopsis thaliana OX=3702 GN=PERK1 PE=1 SV=1
20	AFDB:Q6FSJ1	0.093	0.069	2.820E-1	577	0.121	0.083	Q6FSJ1.pdb.gz	Q6FSJ1_CANGA Candida glabrata strain CBS138 chromosome G complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AWP6 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05423	0.0	794	398	1.000	1.000	RPC4_HUMAN DNA-directed RNA polymerase III subunit RPC4 OS=Homo sapiens OX=9606 GN=POLR3D PE=1 SV=2
2	Q91WD1	0.0	694	398	0.940	0.940	RPC4_MOUSE DNA-directed RNA polymerase III subunit RPC4 OS=Mus musculus OX=10090 GN=Polr3d PE=2 SV=2
3	E5RHT4	4.97e-148	419	207	0.520	1.000	E5RHT4_HUMAN RNA polymerase III subunit D (Fragment) OS=Homo sapiens OX=9606 GN=POLR3D PE=1 SV=1
4	O74857	4.42e-10	62.8	330	0.118	0.142	RPC4_SCHPO DNA-directed RNA polymerase III subunit rpc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc53 PE=2 SV=1
5	P25441	1.40e-05	49.3	422	0.050	0.047	RPC4_YEAST DNA-directed RNA polymerase III subunit RPC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPC53 PE=1 SV=2
6	Q38DU8	0.11	36.6	326	0.058	0.071	Q38DU8_TRYB2 RNA polymerase III RPC4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2090 PE=4 SV=1
7	Q9FWQ5	1.6	33.5	1706	0.088	0.021	HAC12_ARATH Histone acetyltransferase HAC12 OS=Arabidopsis thaliana OX=3702 GN=HAC12 PE=3 SV=2
8	Q12019	3.3	32.7	4910	0.058	0.005	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
9	A0A0A0MRZ4	4.4	32.0	619	0.048	0.031	A0A0A0MRZ4_HUMAN TNFAIP3 interacting protein 1 OS=Homo sapiens OX=9606 GN=TNIP1 PE=1 SV=1
10	Q15025	6.6	31.6	636	0.048	0.030	TNIP1_HUMAN TNFAIP3-interacting protein 1 OS=Homo sapiens OX=9606 GN=TNIP1 PE=1 SV=2
11	O08999	6.9	31.6	1813	0.058	0.013	LTBP2_MOUSE Latent-transforming growth factor beta-binding protein 2 OS=Mus musculus OX=10090 GN=Ltbp2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05132 RNA_pol_Rpc4	3.7e-25	100.5	RNA polymerase III RPC4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380904

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228347	0.999	DNA-directed RNA polymerase III subunit RPC2
2	9606.ENSP00000299853	0.999	DNA-directed RNA polymerase III subunit RPC5
3	9606.ENSP00000334564	0.999	DNA-directed RNA polymerase III subunit RPC3
4	9606.ENSP00000347345	0.999	DNA-directed RNA polymerase III subunit RPC8
5	9606.ENSP00000361446	0.999	DNA-directed RNA polymerase III subunit RPC1
6	9606.ENSP00000361465	0.999	DNA-directed RNA polymerases I and III subunit RPAC1
7	9606.ENSP00000366828	0.999	DNA-directed RNA polymerase III subunit RPC6
8	9606.ENSP00000478303	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC1
9	9606.ENSP00000293860	0.998	DNA-directed RNA polymerase III subunit RPC10
10	9606.ENSP00000302478	0.997	DNA-directed RNA polymerases I and III subunit RPAC2
11	9606.ENSP00000415536	0.995	DNA-directed RNA polymerases I, II, and III subunit RPABC3
12	9606.ENSP00000324124	0.994	DNA-directed RNA polymerases I, II, and III subunit RPABC5
13	9606.ENSP00000382058	0.994	DNA-directed RNA polymerase III subunit RPC7
14	9606.ENSP00000403852	0.989	DNA-directed RNA polymerases I, II, and III subunit RPABC2
15	9606.ENSP00000378736	0.986	DNA-directed RNA polymerase III subunit RPC9
16	9606.ENSP00000358320	0.980	DNA-directed RNA polymerase III subunit RPC7-like
17	9606.ENSP00000342889	0.957	DNA-directed RNA polymerases I, II, and III subunit RPABC4
18	9606.ENSP00000351575	0.944	Transcription factor TFIIIB component B'' homolog
19	9606.ENSP00000448323	0.937	Transcription factor IIIB 90 kDa subunit
20	9606.ENSP00000220659	0.914	Transcription factor IIIB 50 kDa subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	1.000	chromatin binding
GO:0005515	0.865	protein binding
GO:0003824	0.379	catalytic activity
GO:1901363	0.345	heterocyclic compound binding
GO:0003676	0.339	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.975	regulation of biological process
GO:0032479	0.886	regulation of type I interferon production
GO:0001819	0.881	positive regulation of cytokine production
GO:0032648	0.821	regulation of interferon-beta production
GO:0002682	0.797	regulation of immune system process
GO:0031347	0.790	regulation of defense response
GO:0002831	0.789	regulation of response to biotic stimulus
GO:0032101	0.783	regulation of response to external stimulus
GO:0032481	0.776	positive regulation of type I interferon production
GO:0009987	0.731	cellular process
GO:0032728	0.711	positive regulation of interferon-beta production
GO:0008152	0.705	metabolic process
GO:0071704	0.700	organic substance metabolic process
GO:0002833	0.690	positive regulation of response to biotic stimulus
GO:0044238	0.672	primary metabolic process
GO:0006807	0.666	nitrogen compound metabolic process
GO:0050776	0.662	regulation of immune response
GO:0002684	0.662	positive regulation of immune system process
GO:0045089	0.641	positive regulation of innate immune response
GO:0044237	0.633	cellular metabolic process
GO:0043170	0.608	macromolecule metabolic process
GO:0034641	0.605	cellular nitrogen compound metabolic process
GO:0046483	0.600	heterocycle metabolic process
GO:0006139	0.574	nucleobase-containing compound metabolic process
GO:0016070	0.489	RNA metabolic process
GO:0010467	0.483	gene expression
GO:0044271	0.451	cellular nitrogen compound biosynthetic process
GO:0034654	0.431	nucleobase-containing compound biosynthetic process
GO:0009059	0.427	macromolecule biosynthetic process
GO:0006351	0.421	DNA-templated transcription
GO:0050794	0.329	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.996	protein-containing complex
GO:0140513	0.988	nuclear protein-containing complex
GO:1990234	0.986	transferase complex
GO:0140535	0.985	intracellular protein-containing complex
GO:0061695	0.982	transferase complex, transferring phosphorus-containing groups
GO:0005829	0.980	cytosol
GO:0055029	0.967	nuclear DNA-directed RNA polymerase complex
GO:0005666	0.902	RNA polymerase III complex
GO:0043232	0.631	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]