StarFunc result for job id P05496

User Input

>input (136 residues)
MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVS
RDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEA
MGLFCLMVAFLILFAM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05496	1.000	1.000	2.312E-18	136	1.000	1.000	P05496.pdb.gz	AT5G1_HUMAN ATP synthase F(0) complex subunit C1, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MC1 PE=1 SV=2
2	AFDB:Q06645	0.838	0.838	2.055E-16	136	0.875	0.875	Q06645.pdb.gz	AT5G1_RAT ATP synthase F(0) complex subunit C1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mc1 PE=1 SV=1
3	AFDB:P56383	0.683	0.639	2.427E-12	146	0.713	0.664	P56383.pdb.gz	AT5G2_MOUSE ATP synthase F(0) complex subunit C2, mitochondrial OS=Mus musculus OX=10090 GN=Atp5mc2 PE=1 SV=2
4	AFDB:P07926	0.700	0.668	3.845E-12	143	0.676	0.643	P07926.pdb.gz	AT5G2_BOVIN ATP synthase F(0) complex subunit C2, mitochondrial OS=Bos taurus OX=9913 GN=ATP5MC2 PE=1 SV=1
5	AFDB:P48201	0.633	0.611	4.840E-12	142	0.735	0.704	P48201.pdb.gz	AT5G3_HUMAN ATP synthase F(0) complex subunit C3, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MC3 PE=1 SV=1
6	AFDB:Q6NN09	0.567	0.559	3.046E-10	138	0.632	0.623	Q6NN09.pdb.gz	Q6NN09_DROME ATPase protein 9 OS=Drosophila melanogaster OX=7227 GN=ATPsynC PE=1 SV=1
7	AFDB:P16000	0.551	0.524	9.045E-7	143	0.346	0.329	P16000.pdb.gz	ATP9_EMENI ATP synthase subunit 9, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=atp9 PE=3 SV=2
8	AFDB:P00842	0.546	0.505	1.206E-6	147	0.382	0.354	P00842.pdb.gz	ATP9_NEUCR ATP synthase subunit 9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=oli PE=1 SV=1
9	AFDB:O43937	0.524	0.599	2.858E-6	118	0.360	0.415	O43937.pdb.gz	O43937_TRYBB ATPase subunit 9 homolog OS=Trypanosoma brucei brucei OX=5702 PE=2 SV=1
10	AFDB:Q38C84	0.561	0.642	5.381E-6	118	0.375	0.432	Q38C84.pdb.gz	Q38C84_TRYB2 ATPase subunit 9, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6340 PE=1 SV=1
11	PDB:2wpdJ	0.506	0.878	1.383E-4	76	0.331	0.592	2wpdJ.pdb.gz	Crystal Structure of the Mg.Adp-Inhibited State of the Yeast F1C10-ATP Synthase.
12	PDB:8ap9P	0.485	0.836	3.094E-4	78	0.287	0.500	8ap9P.pdb.gz	An ancestral interaction module promotes oligomerization in divergent mitochondrial ATP synthases.
13	PDB:3zk1A	0.528	0.780	2.917E-3	89	0.176	0.270	3zk1A.pdb.gz	A New Type of Na(+)-Driven ATP Synthase Membrane Rotor with a Two-Carboxylate Ion-Coupling Motif.
14	PDB:1a91A	0.284	0.443	8.191E-1	79	0.110	0.190	1a91A.pdb.gz
15	PDB:7nsuD	0.393	0.150	1.157	420	0.051	0.017	7nsuD.pdb.gz
16	PDB:4q4aA	0.307	0.098	1.833	572	0.059	0.014	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
17	PDB:2b5uA	0.398	0.137	1.941	470	0.051	0.015	2b5uA.pdb.gz
18	PDB:5ew5A	0.395	0.131	1.941	490	0.051	0.014	5ew5A.pdb.gz
19	PDB:4k1nA	0.225	0.077	2.307	520	0.074	0.019	4k1nA.pdb.gz
20	PDB:6wlw0	0.383	0.269	2.307	204	0.184	0.123	6wlw0.pdb.gz	Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05496	2.27e-94	270	136	1.000	1.000	AT5G1_HUMAN ATP synthase F(0) complex subunit C1, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MC1 PE=1 SV=2
2	P32876	1.17e-83	243	136	0.919	0.919	AT5G1_BOVIN ATP synthase F(0) complex subunit C1, mitochondrial OS=Bos taurus OX=9913 GN=ATP5MC1 PE=1 SV=1
3	Q9CR84	1.64e-81	237	136	0.897	0.897	AT5G1_MOUSE ATP synthase F(0) complex subunit C1, mitochondrial OS=Mus musculus OX=10090 GN=Atp5mc1 PE=1 SV=1
4	Q06645	1.55e-79	232	136	0.875	0.875	AT5G1_RAT ATP synthase F(0) complex subunit C1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mc1 PE=1 SV=1
5	P56384	5.41e-62	188	141	0.743	0.716	AT5G3_MOUSE ATP synthase F(0) complex subunit C3, mitochondrial OS=Mus musculus OX=10090 GN=Atp5mc3 PE=1 SV=1
6	P48201	3.21e-59	181	142	0.728	0.697	AT5G3_HUMAN ATP synthase F(0) complex subunit C3, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MC3 PE=1 SV=1
7	Q71S46	3.21e-59	181	142	0.728	0.697	AT5G3_RAT ATP synthase F(0) complex subunit C3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mc3 PE=1 SV=1
8	Q3ZC75	5.26e-59	181	141	0.721	0.695	AT5G3_BOVIN ATP synthase F(0) complex subunit C3, mitochondrial OS=Bos taurus OX=9913 GN=ATP5MC3 PE=2 SV=1
9	Q06055	8.56e-57	175	141	0.699	0.674	AT5G2_HUMAN ATP synthase F(0) complex subunit C2, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MC2 PE=1 SV=1
10	P07926	1.98e-55	171	143	0.713	0.678	AT5G2_BOVIN ATP synthase F(0) complex subunit C2, mitochondrial OS=Bos taurus OX=9913 GN=ATP5MC2 PE=1 SV=1
11	Q06646	2.46e-54	169	141	0.699	0.674	AT5G2_RAT ATP synthase F(0) complex subunit C2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mc2 PE=1 SV=1
12	P56383	3.79e-54	168	146	0.676	0.630	AT5G2_MOUSE ATP synthase F(0) complex subunit C2, mitochondrial OS=Mus musculus OX=10090 GN=Atp5mc2 PE=1 SV=2
13	Q6NN09	2.01e-49	156	138	0.610	0.601	Q6NN09_DROME ATPase protein 9 OS=Drosophila melanogaster OX=7227 GN=ATPsynC PE=1 SV=1
14	P61829	1.13e-23	89.4	76	0.331	0.592	ATP9_YEAST ATP synthase subunit 9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OLI1 PE=1 SV=1
15	P00842	8.69e-23	89.0	147	0.360	0.333	ATP9_NEUCR ATP synthase subunit 9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=oli PE=1 SV=1
16	O43937	6.22e-22	86.3	118	0.338	0.390	O43937_TRYBB ATPase subunit 9 homolog OS=Trypanosoma brucei brucei OX=5702 PE=2 SV=1
17	Q385P0	6.22e-22	86.3	118	0.338	0.390	Q385P0_TRYB2 ATPase subunit 9, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2950 PE=3 SV=1
18	Q57WQ3	8.76e-22	85.5	117	0.338	0.393	Q57WQ3_TRYB2 ATPase subunit 9, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.800 PE=3 SV=1
19	Q38C84	1.02e-21	85.5	118	0.309	0.356	Q38C84_TRYB2 ATPase subunit 9, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6340 PE=1 SV=1
20	Q37315	1.35e-18	76.6	88	0.287	0.443	ATP9_DICDI ATP synthase subunit 9, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=atp9 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00137 ATP-synt_C	4.9e-07	41.3	ATP synthase subunit C

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377033

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349142	0.999	ATP synthase subunit gamma, mitochondrial
2	9606.ENSP00000262030	0.997	ATP synthase subunit beta, mitochondrial
3	9606.ENSP00000301587	0.997	ATP synthase subunit d, mitochondrial
4	9606.ENSP00000358737	0.997	ATP synthase F(0) complex subunit B1, mitochondrial
5	9606.ENSP00000381736	0.997	ATP synthase subunit alpha, mitochondrial
6	9606.ENSP00000389649	0.997	ATP synthase-coupling factor 6, mitochondrial
7	9606.ENSP00000215375	0.996	ATP synthase subunit delta, mitochondrial
8	9606.ENSP00000284727	0.994	ATP synthase F(0) complex subunit C3, mitochondrial
9	9606.ENSP00000243997	0.992	ATP synthase subunit epsilon, mitochondrial
10	9606.ENSP00000290299	0.991	ATP synthase subunit O, mitochondrial
11	9606.ENSP00000317159	0.991	Cytochrome c1, heme protein, mitochondrial
12	9606.ENSP00000306003	0.990	ATP synthase subunit e, mitochondrial
13	9606.ENSP00000354632	0.990	ATP synthase subunit a
14	9606.ENSP00000292475	0.988	ATP synthase subunit f, mitochondrial
15	9606.ENSP00000300688	0.984	ATP synthase subunit g, mitochondrial
16	9606.ENSP00000358840	0.977	Up-regulated during skeletal muscle growth protein 5
17	9606.ENSP00000401770	0.971	6.8 kDa mitochondrial proteolipid
18	9606.ENSP00000355265	0.967	ATP synthase protein 8
19	9606.ENSP00000421076	0.951	ATP synthase subunit g 2, mitochondrial
20	9606.ENSP00000216254	0.945	Aconitate hydratase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0022857	0.961	transmembrane transporter activity
GO:0015075	0.723	monoatomic ion transmembrane transporter activity
GO:0003824	0.375	catalytic activity
GO:0015267	0.367	channel activity
GO:0015318	0.330	inorganic molecular entity transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065003	0.986	protein-containing complex assembly
GO:0042221	0.981	response to chemical
GO:0046931	0.970	pore complex assembly
GO:0010243	0.968	response to organonitrogen compound
GO:1901700	0.963	response to oxygen-containing compound
GO:0008152	0.802	metabolic process
GO:0097305	0.779	response to alcohol
GO:0044237	0.776	cellular metabolic process
GO:0044238	0.676	primary metabolic process
GO:0071704	0.675	organic substance metabolic process
GO:0006807	0.626	nitrogen compound metabolic process
GO:1901564	0.552	organonitrogen compound metabolic process
GO:0045471	0.490	response to ethanol
GO:0034641	0.338	cellular nitrogen compound metabolic process
GO:0065007	0.317	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	0.995	mitochondrial inner membrane
GO:0032991	0.985	protein-containing complex
GO:0098800	0.921	inner mitochondrial membrane protein complex
GO:1902494	0.909	catalytic complex
GO:1904949	0.615	ATPase complex
GO:0045259	0.606	proton-transporting ATP synthase complex
GO:1902495	0.573	transmembrane transporter complex
GO:0005753	0.545	mitochondrial proton-transporting ATP synthase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]