StarFunc result for job id P05538

User Input

>input (268 residues)
MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVA
RYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRT
TLQRQVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTSLIR
NGDWTFQILVMLEITPQRGDIYTCQVEHPSLQSPITVEWRAQSESAQSKMLSGIGGFVLG
LIFLGLGLIIRHRGQKGPRGPPPAGLLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05538	1.000	1.000	5.936E-50	268	1.000	1.000	P05538.pdb.gz	DQB2_HUMAN HLA class II histocompatibility antigen, DQ beta 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQB2 PE=1 SV=2
2	AFDB:P29826	0.839	0.855	2.004E-38	263	0.728	0.741	P29826.pdb.gz	HB2B_RAT Rano class II histocompatibility antigen, B-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Bb PE=1 SV=1
3	AFDB:P01920	0.757	0.776	2.563E-36	261	0.784	0.805	P01920.pdb.gz	DQB1_HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQB1 PE=1 SV=2
4	AFDB:P01921	0.695	0.702	3.366E-36	265	0.709	0.717	P01921.pdb.gz	HB2D_MOUSE H-2 class II histocompatibility antigen, A-D beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
5	AFDB:P18211	0.770	0.781	2.671E-35	264	0.601	0.610	P18211.pdb.gz	HB2D_RAT Rano class II histocompatibility antigen, D-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Db1 PE=2 SV=1
6	AFDB:P04230	0.871	0.883	9.358E-35	264	0.608	0.617	P04230.pdb.gz	HB21_MOUSE H-2 class II histocompatibility antigen, E-B beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
7	AFDB:P13762	0.796	0.801	1.371E-34	266	0.619	0.624	P13762.pdb.gz	DRB4_HUMAN HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2
8	AFDB:Q30154	0.849	0.855	1.371E-34	266	0.638	0.643	Q30154.pdb.gz	DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain OS=Homo sapiens OX=9606 GN=HLA-DRB5 PE=1 SV=1
9	AFDB:A0A0G4PYZ0	0.716	0.721	1.901E-34	266	0.631	0.635	A0A0G4PYZ0.pdb.gz	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1
10	AFDB:P79483	0.749	0.754	2.901E-33	266	0.612	0.617	P79483.pdb.gz	DRB3_HUMAN HLA class II histocompatibility antigen, DR beta 3 chain OS=Homo sapiens OX=9606 GN=HLA-DRB3 PE=1 SV=1
11	PDB:6cplA	0.377	0.547	1.023E-13	180	0.153	0.228	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
12	PDB:5j6hA	0.487	0.477	7.585E-12	275	0.175	0.171	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
13	PDB:3es6A	0.497	0.483	8.009E-12	277	0.194	0.188	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
14	PDB:6d7gA	0.440	0.330	8.009E-12	386	0.175	0.122	6d7gA.pdb.gz
15	PDB:6fgbA	0.517	0.522	1.239E-11	265	0.172	0.174	6fgbA.pdb.gz
16	PDB:1cd1A	0.532	0.524	1.308E-11	273	0.179	0.176	1cd1A.pdb.gz
17	PDB:6mp0A	0.465	0.345	1.916E-11	388	0.153	0.106	6mp0A.pdb.gz
18	PDB:6e1iA	0.453	0.340	5.111E-11	389	0.179	0.123	6e1iA.pdb.gz
19	PDB:2qriA	0.498	0.355	6.018E-11	398	0.179	0.121	2qriA.pdb.gz
20	PDB:3s6cA	0.503	0.377	9.830E-11	372	0.164	0.118	3s6cA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05538	0.0	560	268	1.000	1.000	DQB2_HUMAN HLA class II histocompatibility antigen, DQ beta 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQB2 PE=1 SV=2
2	P01920	1.41e-145	410	261	0.787	0.808	DQB1_HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQB1 PE=1 SV=2
3	P29826	5.46e-145	408	263	0.731	0.745	HB2B_RAT Rano class II histocompatibility antigen, B-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Bb PE=1 SV=1
4	P06345	2.17e-138	392	263	0.716	0.730	HB2S_MOUSE H-2 class II histocompatibility antigen, A-S beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
5	P01921	1.97e-137	389	265	0.709	0.717	HB2D_MOUSE H-2 class II histocompatibility antigen, A-D beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
6	P06342	8.17e-137	388	265	0.709	0.717	HB2Q_MOUSE H-2 class II histocompatibility antigen, A-Q beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
7	P14483	7.97e-136	385	265	0.713	0.721	HB2A_MOUSE H-2 class II histocompatibility antigen, A beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
8	P06346	6.86e-133	377	252	0.679	0.722	HB2F_MOUSE H-2 class II histocompatibility antigen, A-F beta chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
9	P06343	3.06e-129	369	263	0.705	0.719	HB2K_MOUSE H-2 class II histocompatibility antigen, A-K beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
10	A0A1C3PI11	3.19e-114	330	258	0.593	0.616	A0A1C3PI11_HUMAN HLA class II histocompatibility antigen DP beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
11	Q95HA4	3.48e-114	330	257	0.593	0.619	Q95HA4_HUMAN HLA-DPB1 protein OS=Homo sapiens OX=9606 PE=1 SV=1
12	Q30059	9.80e-113	327	258	0.590	0.612	Q30059_HUMAN MHC class II lymphocyte antigen beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=2 SV=1
13	P04440	1.66e-112	326	258	0.590	0.612	DPB1_HUMAN HLA class II histocompatibility antigen, DP beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
14	P18468	6.56e-112	325	264	0.593	0.602	HB2I_MOUSE H-2 class II histocompatibility antigen, I-A beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
15	Q30154	2.61e-111	323	266	0.638	0.643	DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain OS=Homo sapiens OX=9606 GN=HLA-DRB5 PE=1 SV=1
16	A0A0G4PYZ0	2.25e-110	321	266	0.631	0.635	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1
17	P13762	9.94e-110	319	266	0.619	0.624	DRB4_HUMAN HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2
18	P01911	7.60e-109	317	266	0.627	0.632	DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=2
19	P04230	1.93e-107	313	264	0.604	0.614	HB21_MOUSE H-2 class II histocompatibility antigen, E-B beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
20	P18211	3.59e-107	313	264	0.601	0.610	HB2D_RAT Rano class II histocompatibility antigen, D-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Db1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	1.1e-24	97.9	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	0.032	25.6	CD80-like C2-set immunoglobulin domain
3	PF07679 I-set	3.5e+02	12.7	Immunoglobulin I-set domain
4	PF00047 ig	1.5	20.4	Immunoglobulin domain
5	PF13895 Ig_2	3.2	19.5	Immunoglobulin domain
6	PF13927 Ig_3	0.0019	30.0	Immunoglobulin domain
7	PF02124 Marek_A	24	16.7	Marek's disease glycoprotein A
8	PF00129 MHC_I	2e+02	12.9	Class I Histocompatibility antigen, domains alpha 1 and 2
9	PF00969 MHC_II_beta	6.6e-30	114.4	Class II histocompatibility antigen, beta domain
10	PF18714 PI-TkoII_IV	3.4e+02	12.3	DNA polymerase II intein Domain IV

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008958919.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008958928.1	0.990	HLA class II histocompatibility antigen, DQ alpha 2 chain-like
2	9597.XP_003808661.1	0.986	Belongs to the MHC class II family.
3	9597.XP_008957594.1	0.985	Belongs to the MHC class II family.
4	9597.XP_003829068.1	0.947	CD74 molecule
5	9597.XP_008958910.1	0.942	HLA class II histocompatibility antigen, DM alpha chain isoform X1
6	9597.XP_008971926.1	0.939	CD4 molecule
7	9597.XP_003829807.1	0.908	HLA class II histocompatibility antigen, DR alpha chain
8	9597.XP_008958927.1	0.907	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 2 bases in 1 codon
9	9597.XP_003808645.1	0.904	Belongs to the MHC class II family.
10	9597.XP_008958907.1	0.871	HLA class II histocompatibility antigen, DO alpha chain isoform X1
11	9597.XP_003823113.1	0.862	Protein tyrosine phosphatase, receptor type C
12	9597.XP_003808649.1	0.854	HLA class II histocompatibility antigen, DM beta chain
13	9597.XP_003824647.1	0.810	CD247 molecule
14	9597.XP_003825233.1	0.789	CD86 molecule
15	9597.XP_008953375.1	0.783	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon
16	9597.XP_003829806.1	0.782	HLA class II histocompatibility antigen, DRB1-4 beta chain
17	9597.XP_008958918.1	0.778	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 8 ESTs, 8 Proteins, and 82% coverage of the annotated genomic feature by RNAseq alignments
18	9597.XP_003825194.1	0.776	CD80 molecule
19	9597.XP_008975264.1	0.729	CD274 molecule
20	9597.XP_003805703.1	0.726	Protein tyrosine phosphatase, non-receptor type 22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003823	0.827	antigen binding
GO:0042605	0.705	peptide antigen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.984	response to stimulus
GO:0002495	0.946	antigen processing and presentation of peptide antigen via MHC class II
GO:0019884	0.931	antigen processing and presentation of exogenous antigen
GO:0002478	0.924	antigen processing and presentation of exogenous peptide antigen
GO:0019886	0.897	antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0065007	0.885	biological regulation
GO:0050789	0.884	regulation of biological process
GO:0009987	0.875	cellular process
GO:0050794	0.740	regulation of cellular process
GO:0006955	0.670	immune response
GO:0002682	0.479	regulation of immune system process
GO:0048518	0.474	positive regulation of biological process
GO:0051716	0.455	cellular response to stimulus
GO:0023052	0.440	signaling
GO:0007154	0.440	cell communication
GO:0002684	0.423	positive regulation of immune system process
GO:0048583	0.415	regulation of response to stimulus
GO:0050778	0.389	positive regulation of immune response
GO:0007165	0.360	signal transduction
GO:0048522	0.320	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.998	endomembrane system
GO:0005886	0.998	plasma membrane
GO:0031410	0.998	cytoplasmic vesicle
GO:0032991	0.996	protein-containing complex
GO:0098552	0.996	side of membrane
GO:0098797	0.994	plasma membrane protein complex
GO:0005794	0.989	Golgi apparatus
GO:0009986	0.987	cell surface
GO:0005765	0.985	lysosomal membrane
GO:0031984	0.979	organelle subcompartment
GO:0030659	0.979	cytoplasmic vesicle membrane
GO:0005768	0.967	endosome
GO:0005789	0.967	endoplasmic reticulum membrane
GO:0042611	0.965	MHC protein complex
GO:0030666	0.963	endocytic vesicle membrane
GO:0030662	0.963	coated vesicle membrane
GO:0042613	0.954	MHC class II protein complex
GO:0030134	0.942	COPII-coated ER to Golgi transport vesicle
GO:0030658	0.936	transport vesicle membrane
GO:0000139	0.928	Golgi membrane
GO:0098553	0.927	lumenal side of endoplasmic reticulum membrane
GO:0012507	0.925	ER to Golgi transport vesicle membrane
GO:0032588	0.918	trans-Golgi network membrane
GO:0030665	0.917	clathrin-coated vesicle membrane
GO:0030669	0.912	clathrin-coated endocytic vesicle membrane
GO:0005770	0.862	late endosome
GO:0009897	0.669	external side of plasma membrane
GO:1903561	0.631	extracellular vesicle
GO:0005771	0.386	multivesicular body
GO:0070062	0.385	extracellular exosome
GO:0010008	0.363	endosome membrane
GO:0005769	0.323	early endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]