StarFunc result for job id P05549

User Input

>input (437 residues)
MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPP
PYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSG
LDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPV
SLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSP
PECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHL
ARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLG
NSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNS
HTDNNAKSSDKEEKHRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A6E1XE14	0.536	0.533	2.121E-55	439	1.000	0.995	A0A6E1XE14.pdb.gz	A0A6E1XE14_HUMAN Transcription factor AP-2-alpha OS=Homo sapiens OX=9606 GN=TFAP2A PE=1 SV=1
2	AFDB:A0A286Y8U3	0.493	0.490	1.854E-40	439	0.716	0.713	A0A286Y8U3.pdb.gz
3	AFDB:Q7Z6R9	0.494	0.477	7.919E-31	452	0.467	0.451	Q7Z6R9.pdb.gz	AP2D_HUMAN Transcription factor AP-2-delta OS=Homo sapiens OX=9606 GN=TFAP2D PE=1 SV=1
4	AFDB:O35177	0.088	0.059	5.197E-1	833	0.153	0.080	O35177.pdb.gz	CASL_MOUSE Enhancer of filamentation 1 OS=Mus musculus OX=10090 GN=Nedd9 PE=1 SV=2
5	AFDB:Q8WQX6	0.071	0.033	8.205E-1	1120	0.140	0.054	Q8WQX6.pdb.gz	TUT1_LEITA Terminal uridylyltransferase 1 OS=Leishmania tarentolae OX=5689 GN=KRET1 PE=1 SV=1
6	AFDB:A0A0B4LFI1	0.091	0.051	8.632E-1	1089	0.135	0.054	A0A0B4LFI1.pdb.gz	A0A0B4LFI1_DROME Stac-like, isoform U OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
7	AFDB:D3ZK73	0.124	0.064	9.081E-1	971	0.149	0.067	D3ZK73.pdb.gz	D3ZK73_RAT Cullin 4B OS=Rattus norvegicus OX=10116 GN=Cul4b PE=1 SV=1
8	AFDB:Q8IJS7	0.091	0.048	1.005	1139	0.098	0.038	Q8IJS7.pdb.gz	Q8IJS7_PLAF7 PRE-binding protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1011800 PE=4 SV=1
9	PDB:3jd5G	0.106	0.165	1.156	208	0.057	0.120	3jd5G.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
10	AFDB:A0A0B4LF79	0.093	0.050	1.170	1000	0.142	0.062	A0A0B4LF79.pdb.gz	A0A0B4LF79_DROME Stac-like, isoform Q OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
11	AFDB:F1NHV6	0.080	0.083	1.434	420	0.114	0.119	F1NHV6.pdb.gz	F1NHV6_CHICK YY2 transcription factor OS=Gallus gallus OX=9031 GN=YY2 PE=1 SV=2
12	PDB:7o4i1	0.140	0.121	1.825	522	0.069	0.057	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
13	PDB:7l08AF	0.102	0.157	3.031	208	0.043	0.091	7l08AF.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
14	PDB:2jj1G	0.081	0.189	3.189	167	0.037	0.096	2jj1G.pdb.gz	Mechanism of Inhibition of Bovine F1-ATPase by Resveratrol and Related Polyphenols.
15	PDB:7bc7A	0.113	0.114	3.189	432	0.064	0.065	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
16	PDB:4p9uE	0.120	0.158	3.355	272	0.062	0.099	4p9uE.pdb.gz	The 40-residue insertion in Vibrio cholerae FadR facilitates binding of an additional fatty acyl-CoA ligand.
17	PDB:5a2oA	0.080	0.076	3.355	470	0.043	0.040	5a2oA.pdb.gz	Molecular Basis of Nitrate Uptake by the Plant Nitrate Transporter Nrt1.1.
18	PDB:5oy0L	0.086	0.171	3.355	157	0.025	0.070	5oy0L.pdb.gz	Structure and function of wild-type and subunit-depleted photosystem I in Synechocystis.
19	PDB:1wn0C	0.103	0.228	3.530	138	0.032	0.101	1wn0C.pdb.gz
20	PDB:7mtdC	0.084	0.057	3.714	783	0.069	0.038	7mtdC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KAT2	0.0	583	459	0.751	0.715	A0A0G2KAT2_RAT Transcription factor AP-2 beta OS=Rattus norvegicus OX=10116 GN=Tfap2b PE=3 SV=1
2	A0A2R8QRQ5	0.0	730	450	0.863	0.838	A0A2R8QRQ5_DANRE Transcription factor AP-2-alpha OS=Danio rerio OX=7955 GN=ap2 PE=1 SV=1
3	A0A6E1XE14	0.0	901	439	1.000	0.995	A0A6E1XE14_HUMAN Transcription factor AP-2-alpha OS=Homo sapiens OX=9606 GN=TFAP2A PE=1 SV=1
4	C1K3N0	0.0	602	328	0.673	0.896	C1K3N0_HUMAN Transcription factor AP-2-alpha OS=Homo sapiens OX=9606 GN=TFAP2A PE=1 SV=1
5	D4A505	0.0	561	441	0.725	0.719	D4A505_RAT Transcription factor AP-2 beta OS=Rattus norvegicus OX=10116 GN=Tfap2b PE=3 SV=2
6	F1QUT4	0.0	703	437	0.835	0.835	F1QUT4_DANRE Transcription factor AP-2-alpha OS=Danio rerio OX=7955 GN=ap2 PE=1 SV=1
7	O13111	0.0	808	437	0.936	0.936	O13111_CHICK Transcription factor AP-2-alpha OS=Gallus gallus OX=9031 PE=2 SV=2
8	O93346	0.0	584	449	0.755	0.735	O93346_CHICK Transcription factor AP-2 beta OS=Gallus gallus OX=9031 PE=2 SV=1
9	P05549	0.0	900	437	1.000	1.000	AP2A_HUMAN Transcription factor AP-2-alpha OS=Homo sapiens OX=9606 GN=TFAP2A PE=1 SV=1
10	P34056	0.0	890	437	0.989	0.989	AP2A_MOUSE Transcription factor AP-2-alpha OS=Mus musculus OX=10090 GN=Tfap2a PE=1 SV=2
11	P58197	0.0	885	437	0.984	0.984	AP2A_RAT Transcription factor AP-2-alpha OS=Rattus norvegicus OX=10116 GN=Tfap2a PE=1 SV=1
12	Q4TTV4	0.0	554	439	0.714	0.711	Q4TTV4_DANRE Transcription factor AP-2 beta isoform OS=Danio rerio OX=7955 GN=zgc:110163 PE=2 SV=1
13	Q5PQZ4	0.0	518	445	0.682	0.670	Q5PQZ4_DANRE Transcription factor AP-2 gamma OS=Danio rerio OX=7955 GN=fb48g05 PE=1 SV=1
14	Q61313	0.0	583	459	0.751	0.715	AP2B_MOUSE Transcription factor AP-2-beta OS=Mus musculus OX=10090 GN=Tfap2b PE=1 SV=2
15	Q6NYI3	0.0	699	425	0.831	0.854	Q6NYI3_DANRE Transcription factor AP-2-alpha OS=Danio rerio OX=7955 GN=ap2 PE=1 SV=1
16	Q92481	0.0	579	460	0.751	0.713	AP2B_HUMAN Transcription factor AP-2-beta OS=Homo sapiens OX=9606 GN=TFAP2B PE=1 SV=2
17	Q92754	6.70e-179	509	450	0.661	0.642	AP2C_HUMAN Transcription factor AP-2 gamma OS=Homo sapiens OX=9606 GN=TFAP2C PE=1 SV=1
18	Q61312	2.30e-177	505	449	0.648	0.630	AP2C_MOUSE Transcription factor AP-2 gamma OS=Mus musculus OX=10090 GN=Tfap2c PE=1 SV=2
19	Q6VUP9	6.10e-153	442	442	0.506	0.500	AP2E_MOUSE Transcription factor AP-2-epsilon OS=Mus musculus OX=10090 GN=Tfap2e PE=1 SV=2
20	Q6P0E7	1.53e-147	428	423	0.588	0.608	AP2E_DANRE Transcription factor AP-2-epsilon OS=Danio rerio OX=7955 GN=tfap2e PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04327 Peptidase_Prp	6e+02	12.2	Cysteine protease Prp
2	PF03299 TF_AP-2	7.6e-78	272.4	Transcription factor AP-2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010373931.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010357914.1	0.869	Potassium channel tetramerization domain containing 15
2	61622.XP_010379056.1	0.863	Potassium channel tetramerization domain containing 1
3	61622.XP_010377825.1	0.830	Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 2
4	61622.XP_010354522.1	0.818	Belongs to the GST superfamily.
5	61622.XP_010375568.1	0.810	E1A binding protein p300
6	61622.XP_010372223.1	0.802	Sp1 transcription factor
7	61622.XP_010378850.1	0.765	Epidermal growth factor receptor isoform X1
8	61622.XP_010374337.1	0.757	CREB binding protein
9	61622.XP_010360689.1	0.753	Acts as a tumor suppressor in many tumor types
10	61622.XP_010383500.1	0.746	AP-2 complex subunit beta isoform X1
11	61622.XP_010377525.1	0.727	V-myc avian myelocytomatosis viral oncogene homolog
12	61622.XP_010362160.1	0.720	RB transcriptional corepressor 1
13	61622.XP_010387523.1	0.708	SRY-box 10
14	61622.XP_010357042.1	0.703	YEATS domain containing 4
15	61622.XP_010352554.1	0.691	Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 4
16	61622.XP_010377602.1	0.689	Erb-b2 receptor tyrosine kinase 2
17	61622.XP_010375595.1	0.678	Nuclear receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the nuclear receptor binds to DNA specific PPAR response elements (PPRE) and modulates the transcription of its target genes, such as acyl-CoA oxidase. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis. ARF6 acts as a key regulator of the tissue-specific adipocyte P2 (aP2) enhancer. Acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated proin [...]
18	61622.XP_010379545.1	0.665	WW domain containing oxidoreductase
19	61622.XP_010387390.1	0.651	Paired like homeodomain 2
20	61622.XP_010373771.1	0.646	Belongs to the peptidase C14A family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515	0.999	protein binding
GO:0043565	0.999	sequence-specific DNA binding
GO:1990837	0.798	sequence-specific double-stranded DNA binding
GO:0001217	0.688	DNA-binding transcription repressor activity
GO:0001227	0.674	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000976	0.623	transcription cis-regulatory region binding
GO:0000977	0.507	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.399	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.380	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.999	regulation of DNA-templated transcription
GO:0032502	0.991	developmental process
GO:0009987	0.989	cellular process
GO:0032501	0.980	multicellular organismal process
GO:0048856	0.971	anatomical structure development
GO:0007275	0.961	multicellular organism development
GO:0048731	0.900	system development
GO:0048513	0.896	animal organ development
GO:0048522	0.866	positive regulation of cellular process
GO:0001822	0.786	kidney development
GO:0009893	0.778	positive regulation of metabolic process
GO:0007423	0.770	sensory organ development
GO:0006357	0.747	regulation of transcription by RNA polymerase II
GO:0048519	0.729	negative regulation of biological process
GO:0010604	0.729	positive regulation of macromolecule metabolic process
GO:0001654	0.728	eye development
GO:0043010	0.724	camera-type eye development
GO:0048523	0.723	negative regulation of cellular process
GO:0051173	0.712	positive regulation of nitrogen compound metabolic process
GO:0031325	0.710	positive regulation of cellular metabolic process
GO:0009653	0.664	anatomical structure morphogenesis
GO:0045935	0.611	positive regulation of nucleobase-containing compound metabolic process
GO:0050896	0.587	response to stimulus
GO:0051254	0.530	positive regulation of RNA metabolic process
GO:0010557	0.529	positive regulation of macromolecule biosynthetic process
GO:0031328	0.520	positive regulation of cellular biosynthetic process
GO:1903508	0.498	positive regulation of nucleic acid-templated transcription
GO:0045893	0.490	positive regulation of DNA-templated transcription
GO:0007399	0.460	nervous system development
GO:0051172	0.459	negative regulation of nitrogen compound metabolic process
GO:0031324	0.458	negative regulation of cellular metabolic process
GO:0030154	0.455	cell differentiation
GO:0010605	0.446	negative regulation of macromolecule metabolic process
GO:0009887	0.442	animal organ morphogenesis
GO:0045934	0.434	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.426	negative regulation of cellular biosynthetic process
GO:0010558	0.423	negative regulation of macromolecule biosynthetic process
GO:0051253	0.414	negative regulation of RNA metabolic process
GO:0045944	0.410	positive regulation of transcription by RNA polymerase II
GO:0045892	0.397	negative regulation of DNA-templated transcription
GO:0048646	0.323	anatomical structure formation involved in morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.960	intracellular organelle lumen
GO:0031981	0.946	nuclear lumen
GO:0005654	0.943	nucleoplasm
GO:0005737	0.360	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]