StarFunc result for job id P05556

User Input

>input (798 residues)
MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVEN
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7nxdB	0.624	0.716	0.000	690	0.861	0.996	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
2	AFDB:A0A286Y9W0	0.970	0.965	0.000	802	0.769	0.766	A0A286Y9W0.pdb.gz
3	AFDB:B3DHB6	0.868	0.871	0.000	795	0.754	0.757	B3DHB6.pdb.gz
4	AFDB:F1N8N7	0.813	0.808	0.000	803	0.843	0.838	F1N8N7.pdb.gz
5	AFDB:P49134	0.923	0.922	0.000	799	0.919	0.917	P49134.pdb.gz	ITB1_RAT Integrin beta-1 OS=Rattus norvegicus OX=10116 GN=Itgb1 PE=2 SV=1
6	AFDB:P32592	0.590	0.611	1.897E-101	769	0.449	0.466	P32592.pdb.gz	ITB2_BOVIN Integrin beta-2 OS=Bos taurus OX=9913 GN=ITGB2 PE=1 SV=1
7	AFDB:P26010	0.607	0.607	3.094E-100	798	0.431	0.431	P26010.pdb.gz	ITB7_HUMAN Integrin beta-7 OS=Homo sapiens OX=9606 GN=ITGB7 PE=1 SV=1
8	AFDB:A8DSD5	0.576	0.596	5.470E-100	769	0.451	0.468	A8DSD5.pdb.gz	A8DSD5_PIG Integrin beta OS=Sus scrofa OX=9823 PE=2 SV=1
9	AFDB:P26011	0.603	0.597	8.150E-100	806	0.416	0.412	P26011.pdb.gz	ITB7_MOUSE Integrin beta-7 OS=Mus musculus OX=10090 GN=Itgb7 PE=1 SV=2
10	AFDB:P11835	0.569	0.588	1.084E-99	771	0.456	0.472	P11835.pdb.gz	ITB2_MOUSE Integrin beta-2 OS=Mus musculus OX=10090 GN=Itgb2 PE=1 SV=2
11	AFDB:P05106	0.577	0.584	1.916E-99	788	0.436	0.442	P05106.pdb.gz	ITB3_HUMAN Integrin beta-3 OS=Homo sapiens OX=9606 GN=ITGB3 PE=1 SV=2
12	PDB:4g1eB	0.560	0.627	4.737E-86	709	0.385	0.433	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
13	PDB:5es4B	0.550	0.644	1.868E-78	674	0.400	0.473	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
14	PDB:1u8cB	0.506	0.668	2.629E-66	599	0.330	0.439	1u8cB.pdb.gz	A novel adaptation of the integrin PSI domain revealed from its crystal structure.
15	PDB:6ujaB	0.425	0.928	3.430E-46	359	0.184	0.409	6ujaB.pdb.gz	Cryo-EM Reveals Integrin-Mediated TGF-beta Activation without Release from Latent TGF-beta.
16	PDB:6zgaB	0.179	0.182	2.195E-8	786	0.041	0.042	6zgaB.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
17	PDB:1m2vA	0.189	0.209	4.874E-8	705	0.054	0.061	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
18	PDB:6zgaA	0.205	0.216	5.782E-8	751	0.058	0.061	6zgaA.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
19	PDB:5kynA	0.186	0.200	1.523E-7	730	0.068	0.074	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
20	PDB:6gym6	0.178	0.389	2.568E-5	335	0.036	0.087	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WXP3	581	693	0.367	0.423	A0A087WXP3_HUMAN Integrin beta OS=Homo sapiens OX=9606 GN=ITGB6 PE=1 SV=1
2	A0A494C0X7	698	769	0.450	0.467	A0A494C0X7_HUMAN Integrin beta OS=Homo sapiens OX=9606 GN=ITGB2 PE=1 SV=1
3	A0A8I5ZKE8	633	799	0.422	0.422	A0A8I5ZKE8_RAT Integrin beta OS=Rattus norvegicus OX=10116 GN=Itgb5 PE=1 SV=1
4	A0A8I5ZTY9	659	762	0.432	0.453	A0A8I5ZTY9_RAT Integrin beta OS=Rattus norvegicus OX=10116 GN=Itgb2 PE=1 SV=1
5	A0A8I6AQL1	614	813	0.416	0.408	A0A8I6AQL1_RAT Integrin beta OS=Rattus norvegicus OX=10116 GN=Itgb5 PE=1 SV=1
6	A8DSD5	684	769	0.455	0.472	A8DSD5_PIG Integrin beta OS=Sus scrofa OX=9823 PE=2 SV=1
7	B2RYB8	682	768	0.445	0.462	B2RYB8_RAT Integrin beta OS=Rattus norvegicus OX=10116 GN=Itgb2 PE=3 SV=1
8	D3DSM0	573	712	0.365	0.409	D3DSM0_HUMAN Integrin beta OS=Homo sapiens OX=9606 GN=ITGB2 PE=1 SV=1
9	E7FCN5	636	768	0.435	0.452	E7FCN5_DANRE Integrin beta OS=Danio rerio OX=7955 GN=itgb2 PE=1 SV=1
10	E9PEE8	621	746	0.401	0.429	E9PEE8_HUMAN Integrin beta OS=Homo sapiens OX=9606 GN=ITGB6 PE=1 SV=1
11	F1QG85	1271	798	0.782	0.782	F1QG85_DANRE Integrin beta OS=Danio rerio OX=7955 GN=itgb1 PE=1 SV=1
12	L7RT22	627	799	0.422	0.422	L7RT22_HUMAN Integrin beta OS=Homo sapiens OX=9606 GN=ITGB5 PE=1 SV=1
13	O54890	689	787	0.440	0.446	ITB3_MOUSE Integrin beta-3 OS=Mus musculus OX=10090 GN=Itgb3 PE=1 SV=2
14	O70309	640	798	0.426	0.426	ITB5_MOUSE Integrin beta-5 OS=Mus musculus OX=10090 GN=Itgb5 PE=1 SV=2
15	P05106	658	788	0.439	0.444	ITB3_HUMAN Integrin beta-3 OS=Homo sapiens OX=9606 GN=ITGB3 PE=1 SV=2
16	P05107	700	769	0.451	0.468	ITB2_HUMAN Integrin beta-2 OS=Homo sapiens OX=9606 GN=ITGB2 PE=1 SV=2
17	P05556	1642	798	1.000	1.000	ITB1_HUMAN Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2
18	P07228	1373	803	0.845	0.839	ITB1_CHICK Integrin beta-1 OS=Gallus gallus OX=9031 GN=ITGB1 PE=1 SV=1
19	P09055	1513	798	0.925	0.925	ITB1_MOUSE Integrin beta-1 OS=Mus musculus OX=10090 GN=Itgb1 PE=1 SV=1
20	P11584	592	846	0.452	0.427	ITBX_DROME Integrin beta-PS OS=Drosophila melanogaster OX=7227 GN=mys PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07974 EGF_2	0.00028	32.5	EGF-like domain
2	PF18372 I-EGF_1	1.6e-08	45.6	Integrin beta epidermal growth factor like domain 1
3	PF00362 Integrin_beta	8.8e-109	374.6	Integrin beta chain VWA domain
4	PF08725 Integrin_b_cyt	2.1e-19	80.2	Integrin beta cytoplasmic domain
5	PF07965 Integrin_B_tail	6e-16	70.0	Integrin beta tail domain
6	PF17205 PSI_integrin	2.5e-08	44.8	Integrin plexin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379350

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000007722	0.999	Integrin alpha-3
2	9606.ENSP00000261023	0.999	Integrin alpha-V
3	9606.ENSP00000282588	0.999	Integrin alpha-1
4	9606.ENSP00000293379	0.999	Integrin alpha-5
5	9606.ENSP00000296585	0.999	Integrin alpha-2
6	9606.ENSP00000341189	0.999	Focal adhesion kinase 1
7	9606.ENSP00000346839	0.999	Fibronectin type III domain containing
8	9606.ENSP00000353850	0.999	Integrin beta-1-binding protein 1
9	9606.ENSP00000371958	0.999	CD9 antigen
10	9606.ENSP00000379975	0.999	Integrin-linked protein kinase
11	9606.ENSP00000380227	0.999	Integrin alpha-4
12	9606.ENSP00000386896	0.999	Integrin alpha-6
13	9606.ENSP00000267257	0.998	Paxillin
14	9606.ENSP00000316029	0.998	Talin-1
15	9606.ENSP00000358866	0.998	Filamin-A
16	9606.ENSP00000275493	0.997	Epidermal growth factor receptor
17	9606.ENSP00000294728	0.997	Vascular cell adhesion protein 1
18	9606.ENSP00000378517	0.997	Osteopontin
19	9606.ENSP00000447730	0.996	CD63 antigen
20	9606.ENSP00000452120	0.996	Integrin alpha-7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046983	0.999	protein dimerization activity
GO:0046982	0.993	protein heterodimerization activity
GO:0044877	0.955	protein-containing complex binding
GO:0050839	0.937	cell adhesion molecule binding
GO:0005102	0.931	signaling receptor binding
GO:0019899	0.917	enzyme binding
GO:0019901	0.893	protein kinase binding
GO:0005178	0.870	integrin binding
GO:0001968	0.718	fibronectin binding
GO:0002020	0.362	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0048518	0.983	positive regulation of biological process
GO:0032502	0.975	developmental process
GO:0050896	0.972	response to stimulus
GO:0032501	0.955	multicellular organismal process
GO:0051239	0.936	regulation of multicellular organismal process
GO:0007155	0.924	cell adhesion
GO:0048856	0.913	anatomical structure development
GO:0071840	0.906	cellular component organization or biogenesis
GO:0009653	0.902	anatomical structure morphogenesis
GO:0050793	0.892	regulation of developmental process
GO:0007275	0.889	multicellular organism development
GO:0016043	0.887	cellular component organization
GO:0048869	0.855	cellular developmental process
GO:0048513	0.852	animal organ development
GO:0030154	0.851	cell differentiation
GO:0016477	0.848	cell migration
GO:0051716	0.824	cellular response to stimulus
GO:0048731	0.823	system development
GO:0051240	0.810	positive regulation of multicellular organismal process
GO:0048522	0.807	positive regulation of cellular process
GO:0022603	0.781	regulation of anatomical structure morphogenesis
GO:0048646	0.772	anatomical structure formation involved in morphogenesis
GO:0051094	0.772	positive regulation of developmental process
GO:0031589	0.761	cell-substrate adhesion
GO:0009888	0.717	tissue development
GO:0023051	0.701	regulation of signaling
GO:0010646	0.701	regulation of cell communication
GO:0048468	0.673	cell development
GO:0023052	0.672	signaling
GO:0045765	0.668	regulation of angiogenesis
GO:0007154	0.666	cell communication
GO:0065008	0.659	regulation of biological quality
GO:0051146	0.659	striated muscle cell differentiation
GO:0006996	0.657	organelle organization
GO:0045766	0.626	positive regulation of angiogenesis
GO:0022607	0.581	cellular component assembly
GO:0007165	0.562	signal transduction
GO:0030029	0.525	actin filament-based process
GO:0033627	0.508	cell adhesion mediated by integrin
GO:0048583	0.505	regulation of response to stimulus
GO:0048519	0.477	negative regulation of biological process
GO:0009966	0.475	regulation of signal transduction
GO:0048523	0.452	negative regulation of cellular process
GO:0072359	0.446	circulatory system development
GO:0097435	0.437	supramolecular fiber organization
GO:0007166	0.428	cell surface receptor signaling pathway
GO:0007010	0.404	cytoskeleton organization
GO:0030334	0.402	regulation of cell migration
GO:0019222	0.399	regulation of metabolic process
GO:0042221	0.398	response to chemical
GO:0040017	0.382	positive regulation of locomotion
GO:0048598	0.382	embryonic morphogenesis
GO:0007160	0.376	cell-matrix adhesion
GO:0007507	0.373	heart development
GO:0048584	0.340	positive regulation of response to stimulus
GO:0031323	0.330	regulation of cellular metabolic process
GO:0060255	0.329	regulation of macromolecule metabolic process
GO:0065009	0.318	regulation of molecular function
GO:0009893	0.317	positive regulation of metabolic process
GO:0051171	0.312	regulation of nitrogen compound metabolic process
GO:0051128	0.307	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.998	protein-containing complex
GO:0005925	0.997	focal adhesion
GO:0098802	0.985	plasma membrane signaling receptor complex
GO:0008305	0.975	integrin complex
GO:0043226	0.953	organelle
GO:0005622	0.947	intracellular anatomical structure
GO:0043227	0.920	membrane-bounded organelle
GO:0005737	0.919	cytoplasm
GO:0005576	0.908	extracellular region
GO:0043229	0.907	intracellular organelle
GO:0043231	0.874	intracellular membrane-bounded organelle
GO:0031982	0.707	vesicle
GO:0009986	0.696	cell surface
GO:0098590	0.624	plasma membrane region
GO:0045202	0.519	synapse
GO:0042995	0.455	cell projection
GO:0031410	0.419	cytoplasmic vesicle
GO:0012505	0.415	endomembrane system
GO:0120025	0.318	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]