StarFunc result for job id P05783

User Input

>input (430 residues)
MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGS
GGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKG
PQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVEN
DIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAP
KSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELR
RTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQA
QEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVS
ETNDTKVLRH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RAY2	0.462	0.462	7.989E-51	430	1.000	1.000	A0A024RAY2.pdb.gz
2	AFDB:P05784	0.576	0.584	1.586E-45	423	0.870	0.884	P05784.pdb.gz	K1C18_MOUSE Keratin, type I cytoskeletal 18 OS=Mus musculus OX=10090 GN=Krt18 PE=1 SV=5
3	AFDB:Q9PWD8	0.496	0.497	1.763E-23	429	0.458	0.459	Q9PWD8.pdb.gz	Q9PWD8_DANRE Type I cytokeratin OS=Danio rerio OX=7955 GN=wu:fa03a08 PE=1 SV=1
4	AFDB:Q6PVZ1	0.597	0.554	2.980E-23	467	0.465	0.428	Q6PVZ1.pdb.gz	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
5	AFDB:Q6IFU8	0.532	0.529	7.970E-23	433	0.428	0.425	Q6IFU8.pdb.gz	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
6	AFDB:P02533	0.526	0.483	1.106E-22	472	0.474	0.432	P02533.pdb.gz	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
7	AFDB:Q1LXJ1	0.554	0.562	1.347E-22	423	0.433	0.440	Q1LXJ1.pdb.gz	Q1LXJ1_DANRE Keratin 17 OS=Danio rerio OX=7955 GN=si:dkeyp-113d7.7 PE=1 SV=1
8	AFDB:Q6IFV1	0.441	0.397	1.438E-22	485	0.467	0.414	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
9	AFDB:P35900	0.528	0.535	2.959E-22	424	0.430	0.436	P35900.pdb.gz	K1C20_HUMAN Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1
10	AFDB:Q61414	0.580	0.555	6.087E-22	452	0.449	0.427	Q61414.pdb.gz	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
11	PDB:4xo1A	0.061	0.333	4.591E-1	60	0.021	0.150	4xo1A.pdb.gz
12	PDB:6fhmA	0.060	0.105	7.266E-1	193	0.019	0.041	6fhmA.pdb.gz
13	PDB:5ondA	0.049	0.123	1.400	135	0.016	0.052	5ondA.pdb.gz	The universally-conserved transcription factor RfaH is recruited to a hairpin structure of the non-template DNA strand.
14	PDB:5cd4I	0.056	0.050	1.943	494	0.007	0.006	5cd4I.pdb.gz	Mechanism of CRISPR-RNA guided recognition of DNA targets in Escherichia coli.
15	PDB:2wj8N	0.035	0.039	2.075	378	0.014	0.016	2wj8N.pdb.gz	Crystal Structure of a Nucleocapsid-Like Nucleoprotein-RNA Complex of Respiratory Syncytial Virus
16	PDB:2ymwB	0.041	0.029	3.744	685	0.012	0.007	2ymwB.pdb.gz
17	PDB:7vdvV	0.060	0.094	3.744	238	0.009	0.017	7vdvV.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
18	PDB:3j16A	0.043	0.047	3.998	386	0.012	0.013	3j16A.pdb.gz	Structural basis of highly conserved ribosome recycling in eukaryotes and archaea.
19	PDB:6k0kC	0.045	0.048	3.998	397	0.023	0.025	6k0kC.pdb.gz	Crystal structure of Escherichia coli pyruvate kinase II
20	PDB:1dw9A	0.045	0.090	4.269	156	0.023	0.064	1dw9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8VZY9	0.0	790	391	0.907	0.997	F8VZY9_HUMAN Keratin 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=1
2	P05783	0.0	870	430	1.000	1.000	K1C18_HUMAN Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2
3	P05784	0.0	722	423	0.842	0.856	K1C18_MOUSE Keratin, type I cytoskeletal 18 OS=Mus musculus OX=10090 GN=Krt18 PE=1 SV=5
4	Q5BJY9	0.0	709	423	0.821	0.835	K1C18_RAT Keratin, type I cytoskeletal 18 OS=Rattus norvegicus OX=10116 GN=Krt18 PE=1 SV=3
5	P19001	2.55e-109	330	403	0.416	0.444	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
6	B1AQ75	2.06e-108	330	473	0.423	0.385	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
7	Q6PVZ1	1.17e-106	325	467	0.414	0.381	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
8	Q6IFU8	1.42e-106	323	433	0.440	0.436	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
9	O76013	1.87e-106	324	467	0.442	0.407	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
10	Q63279	1.93e-106	322	403	0.395	0.422	K1C19_RAT Keratin, type I cytoskeletal 19 OS=Rattus norvegicus OX=10116 GN=Krt19 PE=1 SV=2
11	Q9QWL7	9.36e-106	322	433	0.444	0.441	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
12	Q6IFV3	4.24e-104	318	447	0.395	0.380	K1C15_RAT Keratin, type I cytoskeletal 15 OS=Rattus norvegicus OX=10116 GN=Krt15 PE=1 SV=1
13	Q61414	4.68e-104	318	452	0.379	0.361	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
14	P02533	4.92e-104	318	472	0.407	0.371	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
15	Q04695	1.33e-102	313	432	0.400	0.398	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
16	P08727	1.73e-102	312	400	0.379	0.407	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4
17	P08779	3.73e-102	313	473	0.377	0.342	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
18	Q61781	2.99e-101	311	484	0.372	0.331	K1C14_MOUSE Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2
19	P19012	7.26e-101	310	456	0.374	0.353	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
20	Q6IFV1	1.97e-100	310	485	0.370	0.328	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	2.1e+02	13.4	Afadin- and alpha -actinin-Binding
2	PF11026 DUF2721	4e+02	12.3	Protein of unknown function (DUF2721)
3	PF00038 Filament	2.5e-104	360.9	Intermediate filament protein
4	PF07926 TPR_MLP1_2	7.2	18.1	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373487

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000449404	0.995	Keratin, type II cytoskeletal 8
2	9606.ENSP00000365435	0.947	Tumor necrosis factor receptor superfamily member 1B
3	9606.ENSP00000265164	0.934	Caspase-6
4	9606.ENSP00000261769	0.827	Cadherin-1
5	9606.ENSP00000252242	0.796	Keratin, type II cytoskeletal 5
6	9606.ENSP00000329243	0.795	Keratin, type II cytoskeletal 7
7	9606.ENSP00000263735	0.787	Epithelial cell adhesion molecule
8	9606.ENSP00000379287	0.787	14-3-3 protein zeta/delta
9	9606.ENSP00000262177	0.778	DnaJ homolog subfamily B member 6
10	9606.ENSP00000356985	0.772	Death effector domain-containing protein
11	9606.ENSP00000341268	0.756	Tumor necrosis factor receptor type 1-associated DEATH domain protein
12	9606.ENSP00000379138	0.753	Alpha-fetoprotein
13	9606.ENSP00000369129	0.743	Desmoplakin
14	9606.ENSP00000003084	0.735	Cystic fibrosis transmembrane conductance regulator
15	9606.ENSP00000331678	0.721	Plakophilin-3
16	9606.ENSP00000295897	0.704	Serum albumin
17	9606.ENSP00000255681	0.701	O-acetyl-ADP-ribose deacetylase MACROD1
18	9606.ENSP00000355124	0.696	Keratin, type I cytoskeletal 19
19	9606.ENSP00000413479	0.692	Keratin, type II cytoskeletal 3
20	9606.ENSP00000330101	0.674	Keratin, type II cytoskeletal 2 oral

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.719	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0032502	0.976	developmental process
GO:0050794	0.961	regulation of cellular process
GO:0048856	0.960	anatomical structure development
GO:0050896	0.959	response to stimulus
GO:0051716	0.803	cellular response to stimulus
GO:0051179	0.794	localization
GO:0010033	0.763	response to organic substance
GO:0023052	0.762	signaling
GO:0071840	0.759	cellular component organization or biogenesis
GO:0016043	0.748	cellular component organization
GO:0007154	0.717	cell communication
GO:0007165	0.671	signal transduction
GO:0048518	0.645	positive regulation of biological process
GO:0070887	0.628	cellular response to chemical stimulus
GO:0032501	0.614	multicellular organismal process
GO:0048519	0.587	negative regulation of biological process
GO:0006996	0.585	organelle organization
GO:0006915	0.572	apoptotic process
GO:0019222	0.506	regulation of metabolic process
GO:0048523	0.461	negative regulation of cellular process
GO:0007275	0.410	multicellular organism development
GO:0048522	0.395	positive regulation of cellular process
GO:0060255	0.388	regulation of macromolecule metabolic process
GO:0080090	0.333	regulation of primary metabolic process
GO:0051171	0.323	regulation of nitrogen compound metabolic process
GO:0009888	0.319	tissue development
GO:0048513	0.317	animal organ development
GO:0031323	0.311	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043226	0.998	organelle
GO:0043229	0.992	intracellular organelle
GO:0005829	0.991	cytosol
GO:0043232	0.969	intracellular non-membrane-bounded organelle
GO:0005576	0.893	extracellular region
GO:0005615	0.858	extracellular space
GO:0031982	0.854	vesicle
GO:0016020	0.827	membrane
GO:0071944	0.825	cell periphery
GO:0043231	0.806	intracellular membrane-bounded organelle
GO:0005856	0.732	cytoskeleton
GO:0099512	0.690	supramolecular fiber
GO:0099513	0.683	polymeric cytoskeletal fiber
GO:0045111	0.667	intermediate filament cytoskeleton
GO:0070062	0.462	extracellular exosome
GO:0005882	0.448	intermediate filament
GO:0005886	0.410	plasma membrane
GO:0005634	0.405	nucleus
GO:0045095	0.300	keratin filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]